Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1435817..1436042 | Replicon | chromosome |
Accession | NZ_CP012137 | ||
Organism | Shigella flexneri 2a strain 981 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | AD867_RS07730 | Protein ID | WP_000813254.1 |
Coordinates | 1435887..1436042 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1435817..1435875 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AD867_RS31255 | 1431815..1431984 | + | 170 | Protein_1417 | hypothetical protein | - |
AD867_RS07690 | 1432130..1432876 | + | 747 | WP_000788996.1 | ATP-binding protein | - |
AD867_RS07695 | 1432891..1433313 | + | 423 | WP_001118168.1 | DUF977 family protein | - |
AD867_RS07700 | 1433371..1433727 | + | 357 | WP_005048249.1 | hypothetical protein | - |
AD867_RS07705 | 1433820..1434038 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
AD867_RS07710 | 1434040..1434405 | + | 366 | WP_001229297.1 | HNH endonuclease signature motif containing protein | - |
AD867_RS07715 | 1434402..1435067 | + | 666 | WP_000208062.1 | hypothetical protein | - |
AD867_RS07720 | 1435067..1435432 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
- | 1435817..1435875 | - | 59 | - | - | Antitoxin |
AD867_RS07730 | 1435887..1436042 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
AD867_RS07750 | 1437379..1437978 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
AD867_RS07755 | 1437978..1438268 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
AD867_RS07760 | 1438265..1438819 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
AD867_RS07765 | 1438972..1439145 | + | 174 | WP_000504450.1 | hypothetical protein | - |
AD867_RS07770 | 1439207..1440346 | + | 1140 | WP_000088354.1 | IS3 family transposase | - |
AD867_RS07775 | 1440339..1440899 | + | 561 | WP_072075205.1 | ORF6N domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | ipaH9.8 | 1422785..1476966 | 54181 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T55973 WP_000813254.1 NZ_CP012137:1435887-1436042 [Shigella flexneri 2a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T55973 NZ_CP012137:1435887-1436042 [Shigella flexneri 2a]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT55973 NZ_CP012137:c1435875-1435817 [Shigella flexneri 2a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|