Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1247097..1247319 Replicon chromosome
Accession NZ_CP012127
Organism Escherichia coli strain DH1Ec169

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag ADZ28_RS06170 Protein ID WP_000170963.1
Coordinates 1247097..1247204 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1247252..1247319 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ADZ28_RS06140 1242406..1243488 + 1083 WP_000804726.1 peptide chain release factor 1 -
ADZ28_RS06145 1243488..1244321 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
ADZ28_RS06150 1244318..1244710 + 393 WP_000200374.1 invasion regulator SirB2 -
ADZ28_RS06155 1244714..1245523 + 810 WP_001257044.1 invasion regulator SirB1 -
ADZ28_RS06160 1245559..1246413 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
ADZ28_RS06165 1246562..1246669 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1246717..1246783 + 67 NuclAT_34 - -
- 1246717..1246783 + 67 NuclAT_34 - -
- 1246717..1246783 + 67 NuclAT_34 - -
- 1246717..1246783 + 67 NuclAT_34 - -
- 1246717..1246783 + 67 NuclAT_36 - -
- 1246717..1246783 + 67 NuclAT_36 - -
- 1246717..1246783 + 67 NuclAT_36 - -
- 1246717..1246783 + 67 NuclAT_36 - -
- 1246717..1246783 + 67 NuclAT_38 - -
- 1246717..1246783 + 67 NuclAT_38 - -
- 1246717..1246783 + 67 NuclAT_38 - -
- 1246717..1246783 + 67 NuclAT_38 - -
- 1246717..1246783 + 67 NuclAT_40 - -
- 1246717..1246783 + 67 NuclAT_40 - -
- 1246717..1246783 + 67 NuclAT_40 - -
- 1246717..1246783 + 67 NuclAT_40 - -
- 1246717..1246783 + 67 NuclAT_42 - -
- 1246717..1246783 + 67 NuclAT_42 - -
- 1246717..1246783 + 67 NuclAT_42 - -
- 1246717..1246783 + 67 NuclAT_42 - -
- 1246717..1246783 + 67 NuclAT_44 - -
- 1246717..1246783 + 67 NuclAT_44 - -
- 1246717..1246783 + 67 NuclAT_44 - -
- 1246717..1246783 + 67 NuclAT_44 - -
- 1246719..1246784 + 66 NuclAT_18 - -
- 1246719..1246784 + 66 NuclAT_18 - -
- 1246719..1246784 + 66 NuclAT_18 - -
- 1246719..1246784 + 66 NuclAT_18 - -
- 1246719..1246784 + 66 NuclAT_21 - -
- 1246719..1246784 + 66 NuclAT_21 - -
- 1246719..1246784 + 66 NuclAT_21 - -
- 1246719..1246784 + 66 NuclAT_21 - -
- 1246719..1246784 + 66 NuclAT_24 - -
- 1246719..1246784 + 66 NuclAT_24 - -
- 1246719..1246784 + 66 NuclAT_24 - -
- 1246719..1246784 + 66 NuclAT_24 - -
- 1246719..1246784 + 66 NuclAT_27 - -
- 1246719..1246784 + 66 NuclAT_27 - -
- 1246719..1246784 + 66 NuclAT_27 - -
- 1246719..1246784 + 66 NuclAT_27 - -
- 1246719..1246784 + 66 NuclAT_30 - -
- 1246719..1246784 + 66 NuclAT_30 - -
- 1246719..1246784 + 66 NuclAT_30 - -
- 1246719..1246784 + 66 NuclAT_30 - -
- 1246719..1246784 + 66 NuclAT_33 - -
- 1246719..1246784 + 66 NuclAT_33 - -
- 1246719..1246784 + 66 NuclAT_33 - -
- 1246719..1246784 + 66 NuclAT_33 - -
ADZ28_RS06170 1247097..1247204 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1247252..1247319 + 68 NuclAT_17 - Antitoxin
- 1247252..1247319 + 68 NuclAT_17 - Antitoxin
- 1247252..1247319 + 68 NuclAT_17 - Antitoxin
- 1247252..1247319 + 68 NuclAT_17 - Antitoxin
- 1247252..1247319 + 68 NuclAT_20 - Antitoxin
- 1247252..1247319 + 68 NuclAT_20 - Antitoxin
- 1247252..1247319 + 68 NuclAT_20 - Antitoxin
- 1247252..1247319 + 68 NuclAT_20 - Antitoxin
- 1247252..1247319 + 68 NuclAT_23 - Antitoxin
- 1247252..1247319 + 68 NuclAT_23 - Antitoxin
- 1247252..1247319 + 68 NuclAT_23 - Antitoxin
- 1247252..1247319 + 68 NuclAT_23 - Antitoxin
- 1247252..1247319 + 68 NuclAT_26 - Antitoxin
- 1247252..1247319 + 68 NuclAT_26 - Antitoxin
- 1247252..1247319 + 68 NuclAT_26 - Antitoxin
- 1247252..1247319 + 68 NuclAT_26 - Antitoxin
- 1247252..1247319 + 68 NuclAT_29 - Antitoxin
- 1247252..1247319 + 68 NuclAT_29 - Antitoxin
- 1247252..1247319 + 68 NuclAT_29 - Antitoxin
- 1247252..1247319 + 68 NuclAT_29 - Antitoxin
- 1247252..1247319 + 68 NuclAT_32 - Antitoxin
- 1247252..1247319 + 68 NuclAT_32 - Antitoxin
- 1247252..1247319 + 68 NuclAT_32 - Antitoxin
- 1247252..1247319 + 68 NuclAT_32 - Antitoxin
- 1247253..1247318 + 66 NuclAT_35 - -
- 1247253..1247318 + 66 NuclAT_35 - -
- 1247253..1247318 + 66 NuclAT_35 - -
- 1247253..1247318 + 66 NuclAT_35 - -
- 1247253..1247318 + 66 NuclAT_37 - -
- 1247253..1247318 + 66 NuclAT_37 - -
- 1247253..1247318 + 66 NuclAT_37 - -
- 1247253..1247318 + 66 NuclAT_37 - -
- 1247253..1247318 + 66 NuclAT_39 - -
- 1247253..1247318 + 66 NuclAT_39 - -
- 1247253..1247318 + 66 NuclAT_39 - -
- 1247253..1247318 + 66 NuclAT_39 - -
- 1247253..1247318 + 66 NuclAT_41 - -
- 1247253..1247318 + 66 NuclAT_41 - -
- 1247253..1247318 + 66 NuclAT_41 - -
- 1247253..1247318 + 66 NuclAT_41 - -
- 1247253..1247318 + 66 NuclAT_43 - -
- 1247253..1247318 + 66 NuclAT_43 - -
- 1247253..1247318 + 66 NuclAT_43 - -
- 1247253..1247318 + 66 NuclAT_43 - -
- 1247253..1247318 + 66 NuclAT_45 - -
- 1247253..1247318 + 66 NuclAT_45 - -
- 1247253..1247318 + 66 NuclAT_45 - -
- 1247253..1247318 + 66 NuclAT_45 - -
ADZ28_RS06175 1247632..1247739 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1247787..1247854 + 68 NuclAT_16 - -
- 1247787..1247854 + 68 NuclAT_16 - -
- 1247787..1247854 + 68 NuclAT_16 - -
- 1247787..1247854 + 68 NuclAT_16 - -
- 1247787..1247854 + 68 NuclAT_19 - -
- 1247787..1247854 + 68 NuclAT_19 - -
- 1247787..1247854 + 68 NuclAT_19 - -
- 1247787..1247854 + 68 NuclAT_19 - -
- 1247787..1247854 + 68 NuclAT_22 - -
- 1247787..1247854 + 68 NuclAT_22 - -
- 1247787..1247854 + 68 NuclAT_22 - -
- 1247787..1247854 + 68 NuclAT_22 - -
- 1247787..1247854 + 68 NuclAT_25 - -
- 1247787..1247854 + 68 NuclAT_25 - -
- 1247787..1247854 + 68 NuclAT_25 - -
- 1247787..1247854 + 68 NuclAT_25 - -
- 1247787..1247854 + 68 NuclAT_28 - -
- 1247787..1247854 + 68 NuclAT_28 - -
- 1247787..1247854 + 68 NuclAT_28 - -
- 1247787..1247854 + 68 NuclAT_28 - -
- 1247787..1247854 + 68 NuclAT_31 - -
- 1247787..1247854 + 68 NuclAT_31 - -
- 1247787..1247854 + 68 NuclAT_31 - -
- 1247787..1247854 + 68 NuclAT_31 - -
ADZ28_RS06180 1248143..1249243 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
ADZ28_RS06185 1249513..1249743 + 231 WP_001146444.1 putative cation transport regulator ChaB -
ADZ28_RS06190 1249901..1250596 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
ADZ28_RS06195 1250640..1250993 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T55914 WP_000170963.1 NZ_CP012127:c1247204-1247097 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T55914 NZ_CP012127:c1247204-1247097 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT55914 NZ_CP012127:1247252-1247319 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References