Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1417263..1417480 | Replicon | chromosome |
Accession | NZ_CP012119 | ||
Organism | Staphylococcus aureus strain USA300_2014.C01 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | AC807_RS07895 | Protein ID | WP_001802298.1 |
Coordinates | 1417376..1417480 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 1417263..1417318 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AC807_RS07875 | 1413400..1414065 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
AC807_RS07880 | 1414217..1414537 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
AC807_RS07885 | 1414539..1415519 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
AC807_RS07890 | 1415785..1416876 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 1417263..1417318 | + | 56 | - | - | Antitoxin |
AC807_RS07895 | 1417376..1417480 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
AC807_RS15650 | 1417641..1418124 | - | 484 | Protein_1431 | recombinase family protein | - |
AC807_RS07905 | 1418167..1419303 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
AC807_RS07910 | 1419592..1419684 | + | 93 | WP_001790138.1 | hypothetical protein | - |
AC807_RS07915 | 1420389..1421246 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
AC807_RS07920 | 1421314..1422096 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T55801 WP_001802298.1 NZ_CP012119:c1417480-1417376 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T55801 NZ_CP012119:c1417480-1417376 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT55801 NZ_CP012119:1417263-1417318 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|