Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1038147..1038329 | Replicon | chromosome |
Accession | NZ_CP012119 | ||
Organism | Staphylococcus aureus strain USA300_2014.C01 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | AC807_RS15640 | Protein ID | WP_001801861.1 |
Coordinates | 1038147..1038242 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1038270..1038329 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AC807_RS05405 | 1033807..1034433 | + | 627 | Protein_1001 | hypothetical protein | - |
AC807_RS05410 | 1034474..1034818 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
AC807_RS05415 | 1034916..1035467 | + | 552 | WP_000414205.1 | hypothetical protein | - |
AC807_RS05420 | 1035685..1036326 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
AC807_RS05425 | 1036440..1036625 | - | 186 | WP_000809857.1 | hypothetical protein | - |
AC807_RS05430 | 1036627..1036803 | - | 177 | WP_000375476.1 | hypothetical protein | - |
AC807_RS05435 | 1036814..1037197 | - | 384 | WP_000070811.1 | hypothetical protein | - |
AC807_RS05445 | 1037801..1037944 | - | 144 | WP_001549059.1 | transposase | - |
AC807_RS15640 | 1038147..1038242 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1038270..1038329 | - | 60 | - | - | Antitoxin |
AC807_RS05455 | 1038365..1038466 | + | 102 | WP_001791893.1 | hypothetical protein | - |
AC807_RS05460 | 1038444..1038620 | - | 177 | Protein_1011 | transposase | - |
AC807_RS05465 | 1038814..1039191 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1031247..1056848 | 25601 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T55789 WP_001801861.1 NZ_CP012119:1038147-1038242 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T55789 NZ_CP012119:1038147-1038242 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT55789 NZ_CP012119:c1038329-1038270 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|