Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2178473..2178772 | Replicon | chromosome |
Accession | NZ_CP012018 | ||
Organism | Staphylococcus aureus strain Gv88 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | SAGV88_RS16035 | Protein ID | WP_078156886.1 |
Coordinates | 2178596..2178772 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2178473..2178528 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAGV88_RS11135 | 2175152..2175601 | + | 450 | WP_000727651.1 | chemotaxis-inhibiting protein CHIPS | - |
SAGV88_RS16390 | 2175696..2176031 | - | 336 | Protein_2123 | SH3 domain-containing protein | - |
SAGV88_RS11145 | 2176681..2177172 | - | 492 | WP_000919350.1 | staphylokinase | - |
SAGV88_RS11150 | 2177363..2178118 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
SAGV88_RS11155 | 2178130..2178384 | - | 255 | WP_000611512.1 | phage holin | - |
SAGV88_RS11160 | 2178436..2178543 | + | 108 | Protein_2127 | hypothetical protein | - |
- | 2178465..2178604 | + | 140 | NuclAT_0 | - | - |
- | 2178465..2178604 | + | 140 | NuclAT_0 | - | - |
- | 2178465..2178604 | + | 140 | NuclAT_0 | - | - |
- | 2178465..2178604 | + | 140 | NuclAT_0 | - | - |
- | 2178473..2178528 | + | 56 | - | - | Antitoxin |
SAGV88_RS16035 | 2178596..2178772 | - | 177 | WP_078156886.1 | putative holin-like toxin | Toxin |
SAGV88_RS11165 | 2178922..2179218 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
SAGV88_RS11170 | 2179276..2179563 | - | 288 | WP_001040261.1 | hypothetical protein | - |
SAGV88_RS11175 | 2179610..2179762 | - | 153 | WP_001153681.1 | hypothetical protein | - |
SAGV88_RS11180 | 2179752..2183537 | - | 3786 | WP_000582158.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb | 2172787..2218303 | 45516 | |
- | flank | IS/Tn | - | - | 2173201..2174373 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6873.43 Da Isoelectric Point: 10.6777
>T55518 WP_078156886.1 NZ_CP012018:c2178772-2178596 [Staphylococcus aureus]
MDRWWLSEYKEVVSMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVSMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
>T55518 NZ_CP012018:c2178772-2178596 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGTCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGTCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT55518 NZ_CP012018:2178473-2178528 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|