Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2016413..2016595 | Replicon | chromosome |
| Accession | NZ_CP012018 | ||
| Organism | Staphylococcus aureus strain Gv88 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SAGV88_RS16365 | Protein ID | WP_001801861.1 |
| Coordinates | 2016413..2016508 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2016536..2016595 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAGV88_RS10130 | 2012073..2012699 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| SAGV88_RS10135 | 2012740..2013084 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| SAGV88_RS10140 | 2013182..2013733 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| SAGV88_RS10145 | 2013951..2014592 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SAGV88_RS10150 | 2014706..2014891 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| SAGV88_RS10155 | 2014893..2015069 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| SAGV88_RS10160 | 2015080..2015463 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| SAGV88_RS10170 | 2016067..2016210 | - | 144 | WP_001549059.1 | transposase | - |
| SAGV88_RS16365 | 2016413..2016508 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2016536..2016595 | - | 60 | - | - | Antitoxin |
| SAGV88_RS10175 | 2016631..2016732 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| SAGV88_RS15950 | 2016710..2016886 | - | 177 | Protein_1968 | transposase | - |
| SAGV88_RS10180 | 2017080..2017457 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| SAGV88_RS10185 | 2017978..2019303 | - | 1326 | Protein_1970 | ATP-binding protein | - |
| SAGV88_RS10190 | 2019407..2020579 | + | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1985313..2052436 | 67123 | |
| - | inside | Prophage | - | lukD / hlgA | 1983150..2049766 | 66616 | |
| - | flank | IS/Tn | - | - | 2019407..2020579 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T55515 WP_001801861.1 NZ_CP012018:2016413-2016508 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T55515 NZ_CP012018:2016413-2016508 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT55515 NZ_CP012018:c2016595-2016536 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|