Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2025233..2025415 | Replicon | chromosome |
| Accession | NZ_CP012013 | ||
| Organism | Staphylococcus aureus strain Be62 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SABE62_RS16390 | Protein ID | WP_001801861.1 |
| Coordinates | 2025233..2025328 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2025356..2025415 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SABE62_RS10130 | 2020893..2021519 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| SABE62_RS10135 | 2021560..2021904 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| SABE62_RS10140 | 2022002..2022553 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| SABE62_RS10145 | 2022771..2023412 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SABE62_RS10150 | 2023526..2023711 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| SABE62_RS10155 | 2023713..2023889 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| SABE62_RS10160 | 2023900..2024283 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| SABE62_RS10170 | 2024887..2025030 | - | 144 | WP_001549059.1 | transposase | - |
| SABE62_RS16390 | 2025233..2025328 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2025356..2025415 | - | 60 | - | - | Antitoxin |
| SABE62_RS10175 | 2025451..2025552 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| SABE62_RS15970 | 2025530..2025706 | - | 177 | Protein_1972 | transposase | - |
| SABE62_RS10180 | 2025900..2026277 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T55470 WP_001801861.1 NZ_CP012013:2025233-2025328 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T55470 NZ_CP012013:2025233-2025328 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT55470 NZ_CP012013:c2025415-2025356 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|