Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2011195..2011377 | Replicon | chromosome |
| Accession | NZ_CP012012 | ||
| Organism | Staphylococcus aureus strain HC1335 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SAHC1335_RS16320 | Protein ID | WP_001801861.1 |
| Coordinates | 2011195..2011290 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2011318..2011377 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAHC1335_RS10055 | 2006855..2007481 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| SAHC1335_RS10060 | 2007522..2007866 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| SAHC1335_RS10065 | 2007964..2008515 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| SAHC1335_RS10070 | 2008733..2009374 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SAHC1335_RS10075 | 2009488..2009673 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| SAHC1335_RS10080 | 2009675..2009851 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| SAHC1335_RS10085 | 2009862..2010245 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| SAHC1335_RS10095 | 2010849..2010992 | - | 144 | WP_001549059.1 | transposase | - |
| SAHC1335_RS16320 | 2011195..2011290 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2011318..2011377 | - | 60 | - | - | Antitoxin |
| SAHC1335_RS10100 | 2011413..2011514 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| SAHC1335_RS15860 | 2011492..2011668 | - | 177 | Protein_1958 | transposase | - |
| SAHC1335_RS10105 | 2011862..2012239 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| SAHC1335_RS10110 | 2012760..2014085 | - | 1326 | Protein_1960 | ATP-binding protein | - |
| SAHC1335_RS10115 | 2014189..2015361 | + | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2014189..2015361 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T55447 WP_001801861.1 NZ_CP012012:2011195-2011290 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T55447 NZ_CP012012:2011195-2011290 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT55447 NZ_CP012012:c2011377-2011318 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|