Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2251835..2252051 | Replicon | chromosome |
Accession | NZ_CP011685 | ||
Organism | Staphylococcus aureus strain ZJ5499 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | AB179_RS11455 | Protein ID | WP_001802298.1 |
Coordinates | 2251947..2252051 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2251835..2251890 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AB179_RS11435 | 2248041..2248706 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
AB179_RS11440 | 2248858..2249178 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
AB179_RS11445 | 2249180..2250157 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
AB179_RS11450 | 2250423..2251514 | + | 1092 | WP_063653192.1 | hypothetical protein | - |
- | 2251835..2251890 | + | 56 | - | - | Antitoxin |
AB179_RS11455 | 2251947..2252051 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
AB179_RS15345 | 2252568..2252738 | + | 171 | WP_001792292.1 | transposase | - |
AB179_RS14970 | 2252731..2252889 | + | 159 | WP_001792784.1 | hypothetical protein | - |
AB179_RS11460 | 2253547..2254404 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
AB179_RS11465 | 2254472..2255254 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T54838 WP_001802298.1 NZ_CP011685:c2252051-2251947 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T54838 NZ_CP011685:c2252051-2251947 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT54838 NZ_CP011685:2251835-2251890 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|