Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1909753..1909933 | Replicon | chromosome |
| Accession | NZ_CP011685 | ||
| Organism | Staphylococcus aureus strain ZJ5499 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | AB179_RS15225 | Protein ID | WP_001801861.1 |
| Coordinates | 1909753..1909848 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1909876..1909933 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB179_RS09355 | 1904916..1905566 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| AB179_RS09360 | 1905647..1906642 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| AB179_RS09365 | 1906717..1907343 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| AB179_RS09370 | 1907384..1907725 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| AB179_RS09375 | 1907826..1908398 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| AB179_RS14870 | 1908596..1909608 | - | 1013 | Protein_1806 | IS3 family transposase | - |
| AB179_RS15225 | 1909753..1909848 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1909876..1909933 | - | 58 | - | - | Antitoxin |
| AB179_RS09395 | 1909971..1910072 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| AB179_RS15230 | 1910050..1910211 | - | 162 | Protein_1809 | transposase | - |
| AB179_RS09400 | 1910202..1910696 | - | 495 | Protein_1810 | transposase | - |
| AB179_RS09405 | 1911148..1912377 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| AB179_RS09410 | 1912370..1913926 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| AB179_RS09415 | 1914090..1914224 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T54829 WP_001801861.1 NZ_CP011685:1909753-1909848 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T54829 NZ_CP011685:1909753-1909848 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT54829 NZ_CP011685:c1909933-1909876 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|