Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2419823..2420007 | Replicon | chromosome |
Accession | NZ_CP011528 | ||
Organism | Staphylococcus aureus strain RKI4 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | AA961_RS15370 | Protein ID | WP_000482647.1 |
Coordinates | 2419900..2420007 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2419823..2419883 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AA961_RS15350 | 2415353..2415520 | - | 168 | WP_001790576.1 | hypothetical protein | - |
AA961_RS12315 | 2415751..2417484 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
AA961_RS12320 | 2417509..2419272 | - | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein/permease | - |
- | 2419823..2419883 | + | 61 | - | - | Antitoxin |
AA961_RS15370 | 2419900..2420007 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
AA961_RS12335 | 2420141..2420527 | - | 387 | WP_000779360.1 | flippase GtxA | - |
AA961_RS12340 | 2420785..2421927 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
AA961_RS12345 | 2421987..2422646 | + | 660 | WP_000831298.1 | membrane protein | - |
AA961_RS12350 | 2422828..2424039 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
AA961_RS12355 | 2424162..2424635 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T54490 WP_000482647.1 NZ_CP011528:c2420007-2419900 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T54490 NZ_CP011528:c2420007-2419900 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT54490 NZ_CP011528:2419823-2419883 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|