Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2140919..2141116 | Replicon | chromosome |
Accession | NZ_CP011528 | ||
Organism | Staphylococcus aureus strain RKI4 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | AA961_RS15175 | Protein ID | WP_001802298.1 |
Coordinates | 2141012..2141116 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2140919..2140957 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AA961_RS10820 | 2137094..2137759 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
AA961_RS10825 | 2137911..2138231 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
AA961_RS10830 | 2138233..2139213 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
AA961_RS10835 | 2139479..2140570 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
- | 2140919..2140957 | + | 39 | - | - | Antitoxin |
AA961_RS15175 | 2141012..2141116 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
AA961_RS15780 | 2141633..2141803 | + | 171 | WP_001792292.1 | transposase | - |
AA961_RS15185 | 2141796..2141954 | + | 159 | WP_001792784.1 | hypothetical protein | - |
AA961_RS10845 | 2142612..2143469 | - | 858 | WP_047928586.1 | Cof-type HAD-IIB family hydrolase | - |
AA961_RS10850 | 2143537..2144319 | - | 783 | WP_000908180.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T54488 WP_001802298.1 NZ_CP011528:c2141116-2141012 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T54488 NZ_CP011528:c2141116-2141012 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT54488 NZ_CP011528:2140919-2140957 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|