Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1798831..1799011 | Replicon | chromosome |
Accession | NZ_CP011528 | ||
Organism | Staphylococcus aureus strain RKI4 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | AA961_RS15715 | Protein ID | WP_144412207.1 |
Coordinates | 1798831..1798926 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1798954..1799011 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AA961_RS08820 | 1794887..1795513 | + | 627 | WP_000669028.1 | hypothetical protein | - |
AA961_RS08825 | 1795540..1796283 | + | 744 | WP_175393121.1 | exotoxin | - |
AA961_RS08830 | 1796310..1797062 | + | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
AA961_RS08835 | 1797194..1797750 | - | 557 | Protein_1699 | ImmA/IrrE family metallo-endopeptidase | - |
AA961_RS08840 | 1797934..1798380 | - | 447 | WP_000747805.1 | DUF1433 domain-containing protein | - |
AA961_RS14875 | 1798462..1798687 | - | 226 | Protein_1701 | hypothetical protein | - |
AA961_RS15715 | 1798831..1798926 | + | 96 | WP_144412207.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1798954..1799011 | - | 58 | - | - | Antitoxin |
AA961_RS08845 | 1799577..1801273 | - | 1697 | Protein_1703 | hypothetical protein | - |
AA961_RS08850 | 1801251..1802101 | - | 851 | Protein_1704 | DNA adenine methylase | - |
AA961_RS08855 | 1802140..1803405 | - | 1266 | WP_000072555.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 1792329..1820290 | 27961 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3586.32 Da Isoelectric Point: 9.7764
>T54478 WP_144412207.1 NZ_CP011528:1798831-1798926 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAVAYYTYWLSRRNTK
VMLIFVHIIAPVISGCAVAYYTYWLSRRNTK
Download Length: 96 bp
>T54478 NZ_CP011528:1798831-1798926 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCTGTTGCGTATTATACTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCTGTTGCGTATTATACTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT54478 NZ_CP011528:c1799011-1798954 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|