Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2437042..2437226 | Replicon | chromosome |
Accession | NZ_CP011526 | ||
Organism | Staphylococcus aureus strain DSM 20231 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | AA076_RS15625 | Protein ID | WP_000482650.1 |
Coordinates | 2437119..2437226 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2437042..2437102 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AA076_RS15605 | 2432572..2432739 | - | 168 | WP_001790576.1 | hypothetical protein | - |
AA076_RS12430 | 2432970..2434703 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
AA076_RS12435 | 2434728..2436491 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
- | 2437042..2437102 | + | 61 | - | - | Antitoxin |
AA076_RS15625 | 2437119..2437226 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
AA076_RS12450 | 2437360..2437746 | - | 387 | WP_000779358.1 | flippase GtxA | - |
AA076_RS12455 | 2438014..2439156 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
AA076_RS12460 | 2439216..2439875 | + | 660 | WP_000831298.1 | membrane protein | - |
AA076_RS12465 | 2440057..2441268 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
AA076_RS12470 | 2441391..2441864 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T54474 WP_000482650.1 NZ_CP011526:c2437226-2437119 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T54474 NZ_CP011526:c2437226-2437119 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT54474 NZ_CP011526:2437042-2437102 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|