Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1851598..1851780 | Replicon | chromosome |
Accession | NZ_CP011526 | ||
Organism | Staphylococcus aureus strain DSM 20231 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | AA076_RS15945 | Protein ID | WP_001801861.1 |
Coordinates | 1851598..1851693 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1851721..1851780 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AA076_RS09160 | 1847258..1847884 | + | 627 | WP_000669046.1 | hypothetical protein | - |
AA076_RS09165 | 1847925..1848269 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
AA076_RS09170 | 1848367..1848918 | + | 552 | WP_000414205.1 | hypothetical protein | - |
AA076_RS09175 | 1849136..1849777 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
AA076_RS09180 | 1849891..1850076 | - | 186 | WP_000809857.1 | hypothetical protein | - |
AA076_RS15185 | 1850078..1850254 | - | 177 | WP_000375476.1 | hypothetical protein | - |
AA076_RS09190 | 1850265..1850648 | - | 384 | WP_000070812.1 | hypothetical protein | - |
AA076_RS15195 | 1851252..1851395 | - | 144 | WP_001549059.1 | transposase | - |
AA076_RS15945 | 1851598..1851693 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1851721..1851780 | - | 60 | - | - | Antitoxin |
AA076_RS15200 | 1851816..1851917 | + | 102 | WP_001791893.1 | hypothetical protein | - |
AA076_RS15205 | 1851895..1852071 | - | 177 | Protein_1766 | transposase | - |
AA076_RS09210 | 1852265..1852642 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1825571..1884869 | 59298 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T54467 WP_001801861.1 NZ_CP011526:1851598-1851693 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T54467 NZ_CP011526:1851598-1851693 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT54467 NZ_CP011526:c1851780-1851721 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|