Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2523040..2523262 Replicon chromosome
Accession NZ_CP011495
Organism Escherichia coli strain NCM3722 isolate K-12

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag AA953_RS12585 Protein ID WP_000170963.1
Coordinates 2523040..2523147 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2523195..2523262 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AA953_RS12555 2518349..2519431 + 1083 WP_000804726.1 peptide chain release factor 1 -
AA953_RS12560 2519431..2520264 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
AA953_RS12565 2520261..2520653 + 393 WP_000200374.1 invasion regulator SirB2 -
AA953_RS12570 2520657..2521466 + 810 WP_001257044.1 invasion regulator SirB1 -
AA953_RS12575 2521502..2522356 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AA953_RS12580 2522505..2522612 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2522660..2522726 + 67 NuclAT_34 - -
- 2522660..2522726 + 67 NuclAT_34 - -
- 2522660..2522726 + 67 NuclAT_34 - -
- 2522660..2522726 + 67 NuclAT_34 - -
- 2522660..2522726 + 67 NuclAT_36 - -
- 2522660..2522726 + 67 NuclAT_36 - -
- 2522660..2522726 + 67 NuclAT_36 - -
- 2522660..2522726 + 67 NuclAT_36 - -
- 2522660..2522726 + 67 NuclAT_38 - -
- 2522660..2522726 + 67 NuclAT_38 - -
- 2522660..2522726 + 67 NuclAT_38 - -
- 2522660..2522726 + 67 NuclAT_38 - -
- 2522660..2522726 + 67 NuclAT_40 - -
- 2522660..2522726 + 67 NuclAT_40 - -
- 2522660..2522726 + 67 NuclAT_40 - -
- 2522660..2522726 + 67 NuclAT_40 - -
- 2522660..2522726 + 67 NuclAT_42 - -
- 2522660..2522726 + 67 NuclAT_42 - -
- 2522660..2522726 + 67 NuclAT_42 - -
- 2522660..2522726 + 67 NuclAT_42 - -
- 2522660..2522726 + 67 NuclAT_44 - -
- 2522660..2522726 + 67 NuclAT_44 - -
- 2522660..2522726 + 67 NuclAT_44 - -
- 2522660..2522726 + 67 NuclAT_44 - -
- 2522662..2522727 + 66 NuclAT_18 - -
- 2522662..2522727 + 66 NuclAT_18 - -
- 2522662..2522727 + 66 NuclAT_18 - -
- 2522662..2522727 + 66 NuclAT_18 - -
- 2522662..2522727 + 66 NuclAT_21 - -
- 2522662..2522727 + 66 NuclAT_21 - -
- 2522662..2522727 + 66 NuclAT_21 - -
- 2522662..2522727 + 66 NuclAT_21 - -
- 2522662..2522727 + 66 NuclAT_24 - -
- 2522662..2522727 + 66 NuclAT_24 - -
- 2522662..2522727 + 66 NuclAT_24 - -
- 2522662..2522727 + 66 NuclAT_24 - -
- 2522662..2522727 + 66 NuclAT_27 - -
- 2522662..2522727 + 66 NuclAT_27 - -
- 2522662..2522727 + 66 NuclAT_27 - -
- 2522662..2522727 + 66 NuclAT_27 - -
- 2522662..2522727 + 66 NuclAT_30 - -
- 2522662..2522727 + 66 NuclAT_30 - -
- 2522662..2522727 + 66 NuclAT_30 - -
- 2522662..2522727 + 66 NuclAT_30 - -
- 2522662..2522727 + 66 NuclAT_33 - -
- 2522662..2522727 + 66 NuclAT_33 - -
- 2522662..2522727 + 66 NuclAT_33 - -
- 2522662..2522727 + 66 NuclAT_33 - -
AA953_RS12585 2523040..2523147 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 2523195..2523262 + 68 NuclAT_17 - Antitoxin
- 2523195..2523262 + 68 NuclAT_17 - Antitoxin
- 2523195..2523262 + 68 NuclAT_17 - Antitoxin
- 2523195..2523262 + 68 NuclAT_17 - Antitoxin
- 2523195..2523262 + 68 NuclAT_20 - Antitoxin
- 2523195..2523262 + 68 NuclAT_20 - Antitoxin
- 2523195..2523262 + 68 NuclAT_20 - Antitoxin
- 2523195..2523262 + 68 NuclAT_20 - Antitoxin
- 2523195..2523262 + 68 NuclAT_23 - Antitoxin
- 2523195..2523262 + 68 NuclAT_23 - Antitoxin
- 2523195..2523262 + 68 NuclAT_23 - Antitoxin
- 2523195..2523262 + 68 NuclAT_23 - Antitoxin
- 2523195..2523262 + 68 NuclAT_26 - Antitoxin
- 2523195..2523262 + 68 NuclAT_26 - Antitoxin
- 2523195..2523262 + 68 NuclAT_26 - Antitoxin
- 2523195..2523262 + 68 NuclAT_26 - Antitoxin
- 2523195..2523262 + 68 NuclAT_29 - Antitoxin
- 2523195..2523262 + 68 NuclAT_29 - Antitoxin
- 2523195..2523262 + 68 NuclAT_29 - Antitoxin
- 2523195..2523262 + 68 NuclAT_29 - Antitoxin
- 2523195..2523262 + 68 NuclAT_32 - Antitoxin
- 2523195..2523262 + 68 NuclAT_32 - Antitoxin
- 2523195..2523262 + 68 NuclAT_32 - Antitoxin
- 2523195..2523262 + 68 NuclAT_32 - Antitoxin
- 2523196..2523261 + 66 NuclAT_35 - -
- 2523196..2523261 + 66 NuclAT_35 - -
- 2523196..2523261 + 66 NuclAT_35 - -
- 2523196..2523261 + 66 NuclAT_35 - -
- 2523196..2523261 + 66 NuclAT_37 - -
- 2523196..2523261 + 66 NuclAT_37 - -
- 2523196..2523261 + 66 NuclAT_37 - -
- 2523196..2523261 + 66 NuclAT_37 - -
- 2523196..2523261 + 66 NuclAT_39 - -
- 2523196..2523261 + 66 NuclAT_39 - -
- 2523196..2523261 + 66 NuclAT_39 - -
- 2523196..2523261 + 66 NuclAT_39 - -
- 2523196..2523261 + 66 NuclAT_41 - -
- 2523196..2523261 + 66 NuclAT_41 - -
- 2523196..2523261 + 66 NuclAT_41 - -
- 2523196..2523261 + 66 NuclAT_41 - -
- 2523196..2523261 + 66 NuclAT_43 - -
- 2523196..2523261 + 66 NuclAT_43 - -
- 2523196..2523261 + 66 NuclAT_43 - -
- 2523196..2523261 + 66 NuclAT_43 - -
- 2523196..2523261 + 66 NuclAT_45 - -
- 2523196..2523261 + 66 NuclAT_45 - -
- 2523196..2523261 + 66 NuclAT_45 - -
- 2523196..2523261 + 66 NuclAT_45 - -
AA953_RS12590 2523575..2523682 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2523730..2523797 + 68 NuclAT_16 - -
- 2523730..2523797 + 68 NuclAT_16 - -
- 2523730..2523797 + 68 NuclAT_16 - -
- 2523730..2523797 + 68 NuclAT_16 - -
- 2523730..2523797 + 68 NuclAT_19 - -
- 2523730..2523797 + 68 NuclAT_19 - -
- 2523730..2523797 + 68 NuclAT_19 - -
- 2523730..2523797 + 68 NuclAT_19 - -
- 2523730..2523797 + 68 NuclAT_22 - -
- 2523730..2523797 + 68 NuclAT_22 - -
- 2523730..2523797 + 68 NuclAT_22 - -
- 2523730..2523797 + 68 NuclAT_22 - -
- 2523730..2523797 + 68 NuclAT_25 - -
- 2523730..2523797 + 68 NuclAT_25 - -
- 2523730..2523797 + 68 NuclAT_25 - -
- 2523730..2523797 + 68 NuclAT_25 - -
- 2523730..2523797 + 68 NuclAT_28 - -
- 2523730..2523797 + 68 NuclAT_28 - -
- 2523730..2523797 + 68 NuclAT_28 - -
- 2523730..2523797 + 68 NuclAT_28 - -
- 2523730..2523797 + 68 NuclAT_31 - -
- 2523730..2523797 + 68 NuclAT_31 - -
- 2523730..2523797 + 68 NuclAT_31 - -
- 2523730..2523797 + 68 NuclAT_31 - -
AA953_RS12595 2524086..2525186 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
AA953_RS12600 2525456..2525686 + 231 WP_001146444.1 putative cation transport regulator ChaB -
AA953_RS12605 2525844..2526539 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
AA953_RS12610 2526583..2526936 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T54313 WP_000170963.1 NZ_CP011495:c2523147-2523040 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T54313 NZ_CP011495:c2523147-2523040 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT54313 NZ_CP011495:2523195-2523262 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References