Detailed information of TA system TA054089

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1252365..1252586
• Replicon: chromosome
• Accession: NZ_CP011343
• Organism: Escherichia coli K-12 substr. GM4792

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: D3H2K1
• Locus tag: U069_RS06235
• Protein ID: WP_000170955.1
• Coordinates: 1252365..1252472 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1252520..1252586 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
U069_RS06210	1248209..1249291	+	1083	WP_000804726.1	peptide chain release factor 1	-
U069_RS06215	1249291..1250124	+	834	WP_000456467.1	peptide chain release factor N(5)-glutamine methyltransferase	-
U069_RS06220	1250121..1250513	+	393	WP_000200374.1	invasion regulator SirB2	-
U069_RS06225	1250517..1251326	+	810	WP_001257044.1	invasion regulator SirB1	-
U069_RS06230	1251362..1252216	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
U069_RS06235	1252365..1252472	-	108	WP_000170955.1	small toxic polypeptide LdrA/LdrC	Toxin
-	1252520..1252586	+	67	NuclAT_16	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_16	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_16	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_16	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_17	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_17	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_17	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_17	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_18	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_18	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_18	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_18	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_19	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_19	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_19	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_19	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_20	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_20	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_20	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_20	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_21	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_21	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_21	-	Antitoxin
-	1252520..1252586	+	67	NuclAT_21	-	Antitoxin
U069_RS06240	1252876..1253976	-	1101	WP_000063607.1	sodium-potassium/proton antiporter ChaA	-
U069_RS06245	1254246..1254476	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
U069_RS06250	1254634..1255329	+	696	WP_001336325.1	glutathione-specific gamma-glutamylcyclotransferase	-
U069_RS06255	1255373..1255726	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
U069_RS06260	1255911..1257305	+	1395	WP_000086217.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4013.82 Da
• Isoelectric Point: 11.4779

>T54089 WP_000170955.1 NZ_CP011343:c1252472-1252365 [Escherichia coli K-12]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T54089 NZ_CP011343:c1252472-1252365 [Escherichia coli K-12]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT54089 NZ_CP011343:1252520-1252586 [Escherichia coli K-12]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A829J2A9

Antitoxin