Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1252365..1252586 | Replicon | chromosome |
| Accession | NZ_CP011343 | ||
| Organism | Escherichia coli K-12 substr. GM4792 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | D3H2K1 |
| Locus tag | U069_RS06235 | Protein ID | WP_000170955.1 |
| Coordinates | 1252365..1252472 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1252520..1252586 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U069_RS06210 | 1248209..1249291 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| U069_RS06215 | 1249291..1250124 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| U069_RS06220 | 1250121..1250513 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| U069_RS06225 | 1250517..1251326 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| U069_RS06230 | 1251362..1252216 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| U069_RS06235 | 1252365..1252472 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | Toxin |
| - | 1252520..1252586 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 1252520..1252586 | + | 67 | NuclAT_21 | - | Antitoxin |
| U069_RS06240 | 1252876..1253976 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| U069_RS06245 | 1254246..1254476 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| U069_RS06250 | 1254634..1255329 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| U069_RS06255 | 1255373..1255726 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| U069_RS06260 | 1255911..1257305 | + | 1395 | WP_000086217.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T54089 WP_000170955.1 NZ_CP011343:c1252472-1252365 [Escherichia coli K-12]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T54089 NZ_CP011343:c1252472-1252365 [Escherichia coli K-12]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT54089 NZ_CP011343:1252520-1252586 [Escherichia coli K-12]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|