Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 9381..9645 | Replicon | plasmid unnamed |
| Accession | NZ_CP011333 | ||
| Organism | Escherichia coli O104:H4 str. C227-11 isolate 368 shch | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | AAF13_RS27225 | Protein ID | WP_001387489.1 |
| Coordinates | 9493..9645 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 9381..9443 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAF13_RS27210 | 5483..6553 | - | 1071 | WP_000151588.1 | IncI1-type conjugal transfer protein TrbB | - |
| AAF13_RS27215 | 6572..7780 | - | 1209 | WP_000121263.1 | IncI1-type conjugal transfer protein TrbA | - |
| AAF13_RS27220 | 8087..9178 | - | 1092 | WP_000426061.1 | hypothetical protein | - |
| - | 9381..9443 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 9381..9443 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 9381..9443 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 9381..9443 | - | 63 | NuclAT_0 | - | Antitoxin |
| AAF13_RS27225 | 9493..9645 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| AAF13_RS27230 | 9717..9968 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| AAF13_RS27235 | 10268..10564 | + | 297 | WP_001275298.1 | hypothetical protein | - |
| AAF13_RS32430 | 10629..10805 | - | 177 | WP_001054898.1 | hypothetical protein | - |
| AAF13_RS27250 | 10988..11197 | - | 210 | WP_001140543.1 | hemolysin expression modulator Hha | - |
| AAF13_RS27255 | 11295..11909 | - | 615 | WP_000578648.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| AAF13_RS27260 | 11985..14153 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..16948 | 16948 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T54032 WP_001387489.1 NZ_CP011333:9493-9645 [Escherichia coli O104:H4 str. C227-11]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T54032 NZ_CP011333:9493-9645 [Escherichia coli O104:H4 str. C227-11]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT54032 NZ_CP011333:c9443-9381 [Escherichia coli O104:H4 str. C227-11]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|