Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1263923..1264145 | Replicon | chromosome |
Accession | NZ_CP011322 | ||
Organism | Escherichia coli strain SQ110 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | D3H2K1 |
Locus tag | SG46_RS06155 | Protein ID | WP_000170955.1 |
Coordinates | 1263923..1264030 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1264078..1264145 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SG46_RS06125 | 1259779..1260612 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
SG46_RS06130 | 1260609..1261001 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
SG46_RS06135 | 1261005..1261814 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
SG46_RS06140 | 1261850..1262704 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
SG46_RS06145 | 1262853..1262960 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
- | 1263008..1263074 | + | 67 | NuclAT_34 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_34 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_34 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_34 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_36 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_36 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_36 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_36 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_38 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_38 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_38 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_38 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_40 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_40 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_40 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_40 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_42 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_42 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_42 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_42 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_44 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_44 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_44 | - | - |
- | 1263008..1263074 | + | 67 | NuclAT_44 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_18 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_18 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_18 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_18 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_21 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_21 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_21 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_21 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_24 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_24 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_24 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_24 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_27 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_27 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_27 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_27 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_30 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_30 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_30 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_30 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_33 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_33 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_33 | - | - |
- | 1263010..1263075 | + | 66 | NuclAT_33 | - | - |
SG46_RS06150 | 1263388..1263495 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | - |
- | 1263543..1263610 | + | 68 | NuclAT_17 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_17 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_17 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_17 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_20 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_20 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_20 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_20 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_23 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_23 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_23 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_23 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_26 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_26 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_26 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_26 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_29 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_29 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_29 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_29 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_32 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_32 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_32 | - | - |
- | 1263543..1263610 | + | 68 | NuclAT_32 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_35 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_35 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_35 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_35 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_37 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_37 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_37 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_37 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_39 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_39 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_39 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_39 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_41 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_41 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_41 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_41 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_43 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_43 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_43 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_43 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_45 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_45 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_45 | - | - |
- | 1263544..1263609 | + | 66 | NuclAT_45 | - | - |
SG46_RS06155 | 1263923..1264030 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | Toxin |
- | 1264078..1264145 | + | 68 | NuclAT_16 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_16 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_16 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_16 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_19 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_19 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_19 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_19 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_22 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_22 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_22 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_22 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_25 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_25 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_25 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_25 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_28 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_28 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_28 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_28 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_31 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_31 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_31 | - | Antitoxin |
- | 1264078..1264145 | + | 68 | NuclAT_31 | - | Antitoxin |
SG46_RS06160 | 1264434..1265534 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
SG46_RS06165 | 1265804..1266034 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
SG46_RS06170 | 1266192..1266887 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
SG46_RS06175 | 1266931..1267284 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
SG46_RS06180 | 1267469..1268863 | + | 1395 | WP_000086217.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T53921 WP_000170955.1 NZ_CP011322:c1264030-1263923 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T53921 NZ_CP011322:c1264030-1263923 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 bp
>AT53921 NZ_CP011322:1264078-1264145 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|