53918

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1263388..1263610 Replicon chromosome
Accession NZ_CP011322
Organism Escherichia coli strain SQ110

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag SG46_RS06150 Protein ID WP_000170963.1
Coordinates 1263388..1263495 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1263543..1263610 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SG46_RS06120 1258697..1259779 + 1083 WP_000804726.1 peptide chain release factor 1 -
SG46_RS06125 1259779..1260612 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
SG46_RS06130 1260609..1261001 + 393 WP_000200374.1 invasion regulator SirB2 -
SG46_RS06135 1261005..1261814 + 810 WP_001257044.1 invasion regulator SirB1 -
SG46_RS06140 1261850..1262704 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
SG46_RS06145 1262853..1262960 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1263008..1263074 + 67 NuclAT_34 - -
- 1263008..1263074 + 67 NuclAT_34 - -
- 1263008..1263074 + 67 NuclAT_34 - -
- 1263008..1263074 + 67 NuclAT_34 - -
- 1263008..1263074 + 67 NuclAT_36 - -
- 1263008..1263074 + 67 NuclAT_36 - -
- 1263008..1263074 + 67 NuclAT_36 - -
- 1263008..1263074 + 67 NuclAT_36 - -
- 1263008..1263074 + 67 NuclAT_38 - -
- 1263008..1263074 + 67 NuclAT_38 - -
- 1263008..1263074 + 67 NuclAT_38 - -
- 1263008..1263074 + 67 NuclAT_38 - -
- 1263008..1263074 + 67 NuclAT_40 - -
- 1263008..1263074 + 67 NuclAT_40 - -
- 1263008..1263074 + 67 NuclAT_40 - -
- 1263008..1263074 + 67 NuclAT_40 - -
- 1263008..1263074 + 67 NuclAT_42 - -
- 1263008..1263074 + 67 NuclAT_42 - -
- 1263008..1263074 + 67 NuclAT_42 - -
- 1263008..1263074 + 67 NuclAT_42 - -
- 1263008..1263074 + 67 NuclAT_44 - -
- 1263008..1263074 + 67 NuclAT_44 - -
- 1263008..1263074 + 67 NuclAT_44 - -
- 1263008..1263074 + 67 NuclAT_44 - -
- 1263010..1263075 + 66 NuclAT_18 - -
- 1263010..1263075 + 66 NuclAT_18 - -
- 1263010..1263075 + 66 NuclAT_18 - -
- 1263010..1263075 + 66 NuclAT_18 - -
- 1263010..1263075 + 66 NuclAT_21 - -
- 1263010..1263075 + 66 NuclAT_21 - -
- 1263010..1263075 + 66 NuclAT_21 - -
- 1263010..1263075 + 66 NuclAT_21 - -
- 1263010..1263075 + 66 NuclAT_24 - -
- 1263010..1263075 + 66 NuclAT_24 - -
- 1263010..1263075 + 66 NuclAT_24 - -
- 1263010..1263075 + 66 NuclAT_24 - -
- 1263010..1263075 + 66 NuclAT_27 - -
- 1263010..1263075 + 66 NuclAT_27 - -
- 1263010..1263075 + 66 NuclAT_27 - -
- 1263010..1263075 + 66 NuclAT_27 - -
- 1263010..1263075 + 66 NuclAT_30 - -
- 1263010..1263075 + 66 NuclAT_30 - -
- 1263010..1263075 + 66 NuclAT_30 - -
- 1263010..1263075 + 66 NuclAT_30 - -
- 1263010..1263075 + 66 NuclAT_33 - -
- 1263010..1263075 + 66 NuclAT_33 - -
- 1263010..1263075 + 66 NuclAT_33 - -
- 1263010..1263075 + 66 NuclAT_33 - -
SG46_RS06150 1263388..1263495 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1263543..1263610 + 68 NuclAT_17 - Antitoxin
- 1263543..1263610 + 68 NuclAT_17 - Antitoxin
- 1263543..1263610 + 68 NuclAT_17 - Antitoxin
- 1263543..1263610 + 68 NuclAT_17 - Antitoxin
- 1263543..1263610 + 68 NuclAT_20 - Antitoxin
- 1263543..1263610 + 68 NuclAT_20 - Antitoxin
- 1263543..1263610 + 68 NuclAT_20 - Antitoxin
- 1263543..1263610 + 68 NuclAT_20 - Antitoxin
- 1263543..1263610 + 68 NuclAT_23 - Antitoxin
- 1263543..1263610 + 68 NuclAT_23 - Antitoxin
- 1263543..1263610 + 68 NuclAT_23 - Antitoxin
- 1263543..1263610 + 68 NuclAT_23 - Antitoxin
- 1263543..1263610 + 68 NuclAT_26 - Antitoxin
- 1263543..1263610 + 68 NuclAT_26 - Antitoxin
- 1263543..1263610 + 68 NuclAT_26 - Antitoxin
- 1263543..1263610 + 68 NuclAT_26 - Antitoxin
- 1263543..1263610 + 68 NuclAT_29 - Antitoxin
- 1263543..1263610 + 68 NuclAT_29 - Antitoxin
- 1263543..1263610 + 68 NuclAT_29 - Antitoxin
- 1263543..1263610 + 68 NuclAT_29 - Antitoxin
- 1263543..1263610 + 68 NuclAT_32 - Antitoxin
- 1263543..1263610 + 68 NuclAT_32 - Antitoxin
- 1263543..1263610 + 68 NuclAT_32 - Antitoxin
- 1263543..1263610 + 68 NuclAT_32 - Antitoxin
- 1263544..1263609 + 66 NuclAT_35 - -
- 1263544..1263609 + 66 NuclAT_35 - -
- 1263544..1263609 + 66 NuclAT_35 - -
- 1263544..1263609 + 66 NuclAT_35 - -
- 1263544..1263609 + 66 NuclAT_37 - -
- 1263544..1263609 + 66 NuclAT_37 - -
- 1263544..1263609 + 66 NuclAT_37 - -
- 1263544..1263609 + 66 NuclAT_37 - -
- 1263544..1263609 + 66 NuclAT_39 - -
- 1263544..1263609 + 66 NuclAT_39 - -
- 1263544..1263609 + 66 NuclAT_39 - -
- 1263544..1263609 + 66 NuclAT_39 - -
- 1263544..1263609 + 66 NuclAT_41 - -
- 1263544..1263609 + 66 NuclAT_41 - -
- 1263544..1263609 + 66 NuclAT_41 - -
- 1263544..1263609 + 66 NuclAT_41 - -
- 1263544..1263609 + 66 NuclAT_43 - -
- 1263544..1263609 + 66 NuclAT_43 - -
- 1263544..1263609 + 66 NuclAT_43 - -
- 1263544..1263609 + 66 NuclAT_43 - -
- 1263544..1263609 + 66 NuclAT_45 - -
- 1263544..1263609 + 66 NuclAT_45 - -
- 1263544..1263609 + 66 NuclAT_45 - -
- 1263544..1263609 + 66 NuclAT_45 - -
SG46_RS06155 1263923..1264030 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1264078..1264145 + 68 NuclAT_16 - -
- 1264078..1264145 + 68 NuclAT_16 - -
- 1264078..1264145 + 68 NuclAT_16 - -
- 1264078..1264145 + 68 NuclAT_16 - -
- 1264078..1264145 + 68 NuclAT_19 - -
- 1264078..1264145 + 68 NuclAT_19 - -
- 1264078..1264145 + 68 NuclAT_19 - -
- 1264078..1264145 + 68 NuclAT_19 - -
- 1264078..1264145 + 68 NuclAT_22 - -
- 1264078..1264145 + 68 NuclAT_22 - -
- 1264078..1264145 + 68 NuclAT_22 - -
- 1264078..1264145 + 68 NuclAT_22 - -
- 1264078..1264145 + 68 NuclAT_25 - -
- 1264078..1264145 + 68 NuclAT_25 - -
- 1264078..1264145 + 68 NuclAT_25 - -
- 1264078..1264145 + 68 NuclAT_25 - -
- 1264078..1264145 + 68 NuclAT_28 - -
- 1264078..1264145 + 68 NuclAT_28 - -
- 1264078..1264145 + 68 NuclAT_28 - -
- 1264078..1264145 + 68 NuclAT_28 - -
- 1264078..1264145 + 68 NuclAT_31 - -
- 1264078..1264145 + 68 NuclAT_31 - -
- 1264078..1264145 + 68 NuclAT_31 - -
- 1264078..1264145 + 68 NuclAT_31 - -
SG46_RS06160 1264434..1265534 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
SG46_RS06165 1265804..1266034 + 231 WP_001146444.1 putative cation transport regulator ChaB -
SG46_RS06170 1266192..1266887 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
SG46_RS06175 1266931..1267284 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T53918 WP_000170963.1 NZ_CP011322:c1263495-1263388 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T53918 NZ_CP011322:c1263495-1263388 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT53918 NZ_CP011322:1263543-1263610 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References