Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1263389..1263611 | Replicon | chromosome |
| Accession | NZ_CP011321 | ||
| Organism | Escherichia coli strain SQ88 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | SG49_RS06300 | Protein ID | WP_000170963.1 |
| Coordinates | 1263389..1263496 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1263544..1263611 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SG49_RS06270 | 1258698..1259780 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| SG49_RS06275 | 1259780..1260613 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| SG49_RS06280 | 1260610..1261002 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| SG49_RS06285 | 1261006..1261815 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| SG49_RS06290 | 1261851..1262705 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| SG49_RS06295 | 1262854..1262961 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 1263009..1263075 | + | 67 | NuclAT_34 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_34 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_34 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_34 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_36 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_36 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_36 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_36 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_38 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_38 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_38 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_38 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_40 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_40 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_40 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_40 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_42 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_42 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_42 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_42 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_44 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_44 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_44 | - | - |
| - | 1263009..1263075 | + | 67 | NuclAT_44 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_18 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_18 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_18 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_18 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_21 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_21 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_21 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_21 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_24 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_24 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_24 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_24 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_27 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_27 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_27 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_27 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_30 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_30 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_30 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_30 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_33 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_33 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_33 | - | - |
| - | 1263011..1263076 | + | 66 | NuclAT_33 | - | - |
| SG49_RS06300 | 1263389..1263496 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | Toxin |
| - | 1263544..1263611 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_29 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_29 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_29 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_29 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_32 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_32 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_32 | - | Antitoxin |
| - | 1263544..1263611 | + | 68 | NuclAT_32 | - | Antitoxin |
| - | 1263545..1263610 | + | 66 | NuclAT_35 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_35 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_35 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_35 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_37 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_37 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_37 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_37 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_39 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_39 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_39 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_39 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_41 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_41 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_41 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_41 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_43 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_43 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_43 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_43 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_45 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_45 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_45 | - | - |
| - | 1263545..1263610 | + | 66 | NuclAT_45 | - | - |
| SG49_RS06305 | 1263924..1264031 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 1264079..1264146 | + | 68 | NuclAT_16 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_16 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_16 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_16 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_19 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_19 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_19 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_19 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_22 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_22 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_22 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_22 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_25 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_25 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_25 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_25 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_28 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_28 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_28 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_28 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_31 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_31 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_31 | - | - |
| - | 1264079..1264146 | + | 68 | NuclAT_31 | - | - |
| SG49_RS06310 | 1264435..1265535 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| SG49_RS06315 | 1265805..1266035 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| SG49_RS06320 | 1266193..1266888 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| SG49_RS06325 | 1266932..1267285 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T53875 WP_000170963.1 NZ_CP011321:c1263496-1263389 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T53875 NZ_CP011321:c1263496-1263389 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 bp
>AT53875 NZ_CP011321:1263544-1263611 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|