Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2080255..2080554 | Replicon | chromosome |
Accession | NZ_CP011147 | ||
Organism | Staphylococcus aureus strain FCFHV36 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | FCFHV36_RS15645 | Protein ID | WP_011447039.1 |
Coordinates | 2080378..2080554 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2080255..2080310 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FCFHV36_RS15620 | 2075586..2075846 | + | 261 | WP_001791826.1 | hypothetical protein | - |
FCFHV36_RS10440 | 2075899..2076249 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
FCFHV36_RS10445 | 2076934..2077383 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
FCFHV36_RS16300 | 2077478..2077813 | - | 336 | Protein_1985 | SH3 domain-containing protein | - |
FCFHV36_RS10455 | 2078463..2078954 | - | 492 | WP_000919350.1 | staphylokinase | - |
FCFHV36_RS10460 | 2079145..2079900 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
FCFHV36_RS10465 | 2079912..2080166 | - | 255 | WP_000611512.1 | phage holin | - |
FCFHV36_RS15640 | 2080218..2080325 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2080247..2080386 | + | 140 | NuclAT_0 | - | - |
- | 2080247..2080386 | + | 140 | NuclAT_0 | - | - |
- | 2080247..2080386 | + | 140 | NuclAT_0 | - | - |
- | 2080247..2080386 | + | 140 | NuclAT_0 | - | - |
- | 2080255..2080310 | + | 56 | - | - | Antitoxin |
FCFHV36_RS15645 | 2080378..2080554 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
FCFHV36_RS10480 | 2080704..2081000 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
FCFHV36_RS10485 | 2081058..2081345 | - | 288 | WP_001040261.1 | hypothetical protein | - |
FCFHV36_RS15650 | 2081392..2081544 | - | 153 | WP_001153681.1 | hypothetical protein | - |
FCFHV36_RS10495 | 2081534..2085319 | - | 3786 | WP_000582154.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2075899..2126392 | 50493 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T53569 WP_011447039.1 NZ_CP011147:c2080554-2080378 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T53569 NZ_CP011147:c2080554-2080378 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT53569 NZ_CP011147:2080255-2080310 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|