Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1391899..1392115 | Replicon | chromosome |
Accession | NZ_CP010998 | ||
Organism | Staphylococcus aureus strain FORC_012 isolate human sputum |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | FORC12_RS07265 | Protein ID | WP_001802298.1 |
Coordinates | 1392011..1392115 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 1391899..1391954 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FORC12_RS07245 | 1388102..1388767 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
FORC12_RS07250 | 1388919..1389239 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
FORC12_RS07255 | 1389241..1390221 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
FORC12_RS07260 | 1390487..1391578 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
- | 1391899..1391954 | + | 56 | - | - | Antitoxin |
FORC12_RS07265 | 1392011..1392115 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
FORC12_RS14505 | 1392795..1392953 | + | 159 | WP_001792784.1 | hypothetical protein | - |
FORC12_RS07270 | 1393611..1394468 | - | 858 | WP_000370928.1 | Cof-type HAD-IIB family hydrolase | - |
FORC12_RS07275 | 1394536..1395318 | - | 783 | WP_000908189.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T53160 WP_001802298.1 NZ_CP010998:c1392115-1392011 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T53160 NZ_CP010998:c1392115-1392011 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT53160 NZ_CP010998:1391899-1391954 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|