Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF4/- |
Location | 1218971..1219270 | Replicon | chromosome |
Accession | NZ_CP010998 | ||
Organism | Staphylococcus aureus strain FORC_012 isolate human sputum |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | FORC12_RS14460 | Protein ID | WP_011447039.1 |
Coordinates | 1219094..1219270 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 1218971..1219026 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FORC12_RS06270 | 1214313..1214573 | + | 261 | WP_001791826.1 | hypothetical protein | - |
FORC12_RS06275 | 1214626..1214966 | - | 341 | Protein_1177 | complement inhibitor SCIN-A | - |
FORC12_RS06280 | 1215650..1216099 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
FORC12_RS14970 | 1216194..1216529 | - | 336 | Protein_1179 | SH3 domain-containing protein | - |
FORC12_RS06290 | 1217179..1217670 | - | 492 | WP_000919350.1 | staphylokinase | - |
FORC12_RS06295 | 1217861..1218616 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
FORC12_RS06300 | 1218628..1218882 | - | 255 | WP_000611512.1 | phage holin | - |
FORC12_RS06305 | 1218934..1219041 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1218963..1219102 | + | 140 | NuclAT_0 | - | - |
- | 1218963..1219102 | + | 140 | NuclAT_0 | - | - |
- | 1218963..1219102 | + | 140 | NuclAT_0 | - | - |
- | 1218963..1219102 | + | 140 | NuclAT_0 | - | - |
- | 1218971..1219026 | + | 56 | - | - | Antitoxin |
FORC12_RS14460 | 1219094..1219270 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
FORC12_RS06310 | 1219420..1219716 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
FORC12_RS06315 | 1219774..1220061 | - | 288 | WP_001040261.1 | hypothetical protein | - |
FORC12_RS06320 | 1220108..1220260 | - | 153 | WP_001153681.1 | hypothetical protein | - |
FORC12_RS06325 | 1220250..1224035 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / scn / chp / sak / hlb | 1214626..1259007 | 44381 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T53156 WP_011447039.1 NZ_CP010998:c1219270-1219094 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T53156 NZ_CP010998:c1219270-1219094 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT53156 NZ_CP010998:1218971-1219026 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|