Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1054780..1054960 | Replicon | chromosome |
Accession | NZ_CP010998 | ||
Organism | Staphylococcus aureus strain FORC_012 isolate human sputum |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | FORC12_RS15120 | Protein ID | WP_001801861.1 |
Coordinates | 1054780..1054875 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1054903..1054960 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FORC12_RS05225 | 1049821..1050447 | + | 627 | WP_000669021.1 | hypothetical protein | - |
FORC12_RS05230 | 1050488..1050829 | + | 342 | WP_000627547.1 | DUF3969 family protein | - |
FORC12_RS05235 | 1050930..1051502 | + | 573 | WP_000414206.1 | hypothetical protein | - |
FORC12_RS05240 | 1051700..1052257 | - | 558 | WP_000864139.1 | ImmA/IrrE family metallo-endopeptidase | - |
FORC12_RS05250 | 1052628..1052804 | - | 177 | WP_000375476.1 | hypothetical protein | - |
FORC12_RS05255 | 1052815..1053198 | - | 384 | WP_000070811.1 | hypothetical protein | - |
FORC12_RS05260 | 1053883..1054329 | - | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
FORC12_RS15120 | 1054780..1054875 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1054903..1054960 | - | 58 | - | - | Antitoxin |
FORC12_RS05270 | 1054998..1055099 | + | 102 | WP_001791232.1 | hypothetical protein | - |
FORC12_RS14410 | 1055077..1055259 | - | 183 | Protein_1020 | transposase | - |
FORC12_RS05275 | 1055447..1055821 | - | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
FORC12_RS05280 | 1055843..1056190 | - | 348 | WP_001566695.1 | DUF1433 domain-containing protein | - |
FORC12_RS05285 | 1056427..1056843 | - | 417 | WP_020978241.1 | DUF1433 domain-containing protein | - |
FORC12_RS05290 | 1057490..1058608 | - | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 1025245..1091073 | 65828 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T53152 WP_001801861.1 NZ_CP010998:1054780-1054875 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T53152 NZ_CP010998:1054780-1054875 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT53152 NZ_CP010998:c1054960-1054903 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|