Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 28141..28405 | Replicon | plasmid pFORC11.2 |
Accession | NZ_CP010831 | ||
Organism | Shigella sonnei strain FORC_011 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | E6BRV3 |
Locus tag | FORC11_RS26625 | Protein ID | WP_001303307.1 |
Coordinates | 28141..28293 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 28343..28405 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FORC11_RS26595 (23344) | 23344..25512 | + | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
FORC11_RS26600 (25588) | 25588..26202 | + | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
FORC11_RS26605 (26300) | 26300..26509 | + | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
FORC11_RS33740 (26718) | 26718..26894 | + | 177 | WP_001054900.1 | hypothetical protein | - |
- (27380) | 27380..27431 | + | 52 | NuclAT_1 | - | - |
- (27380) | 27380..27431 | + | 52 | NuclAT_1 | - | - |
- (27380) | 27380..27431 | + | 52 | NuclAT_1 | - | - |
- (27380) | 27380..27431 | + | 52 | NuclAT_1 | - | - |
FORC11_RS26620 (27818) | 27818..28069 | + | 252 | WP_001291965.1 | hypothetical protein | - |
FORC11_RS26625 (28141) | 28141..28293 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
- (28343) | 28343..28405 | + | 63 | NuclAT_0 | - | Antitoxin |
- (28343) | 28343..28405 | + | 63 | NuclAT_0 | - | Antitoxin |
- (28343) | 28343..28405 | + | 63 | NuclAT_0 | - | Antitoxin |
- (28343) | 28343..28405 | + | 63 | NuclAT_0 | - | Antitoxin |
FORC11_RS26630 (28585) | 28585..29793 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
FORC11_RS26635 (29812) | 29812..30882 | + | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
FORC11_RS26640 (30875) | 30875..33166 | + | 2292 | WP_094190802.1 | F-type conjugative transfer protein TrbC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..83905 | 83905 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T52948 WP_001303307.1 NZ_CP010831:c28293-28141 [Shigella sonnei]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T52948 NZ_CP010831:c28293-28141 [Shigella sonnei]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT52948 NZ_CP010831:28343-28405 [Shigella sonnei]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|