Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2540755..2540939 | Replicon | chromosome |
| Accession | NZ_CP010526 | ||
| Organism | Staphylococcus aureus subsp. aureus ST772-MRSA-V strain DAR4145 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | RU53_RS15865 | Protein ID | WP_000482647.1 |
| Coordinates | 2540832..2540939 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2540755..2540815 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RU53_RS15850 | 2536206..2536373 | - | 168 | Protein_2449 | hypothetical protein | - |
| RU53_RS12920 | 2536604..2538337 | - | 1734 | WP_000486506.1 | ABC transporter ATP-binding protein/permease | - |
| RU53_RS12925 | 2538362..2540125 | - | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2540755..2540815 | + | 61 | - | - | Antitoxin |
| RU53_RS15865 | 2540832..2540939 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| RU53_RS12940 | 2541073..2541459 | - | 387 | WP_000779360.1 | flippase GtxA | - |
| RU53_RS12945 | 2541717..2542859 | + | 1143 | WP_001837638.1 | glycerate kinase | - |
| RU53_RS12950 | 2542919..2543578 | + | 660 | WP_000831301.1 | membrane protein | - |
| RU53_RS12955 | 2543760..2544971 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| RU53_RS12960 | 2545094..2545567 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T52784 WP_000482647.1 NZ_CP010526:c2540939-2540832 [Staphylococcus aureus subsp. aureus ST772-MRSA-V]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T52784 NZ_CP010526:c2540939-2540832 [Staphylococcus aureus subsp. aureus ST772-MRSA-V]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT52784 NZ_CP010526:2540755-2540815 [Staphylococcus aureus subsp. aureus ST772-MRSA-V]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|