Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
| Location | 2258361..2258577 | Replicon | chromosome |
| Accession | NZ_CP010526 | ||
| Organism | Staphylococcus aureus subsp. aureus ST772-MRSA-V strain DAR4145 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | RU53_RS15680 | Protein ID | WP_001802298.1 |
| Coordinates | 2258473..2258577 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2258361..2258416 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RU53_RS11405 | 2254567..2255232 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
| RU53_RS11410 | 2255384..2255704 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| RU53_RS11415 | 2255706..2256683 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
| RU53_RS11420 | 2256949..2258040 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
| - | 2258361..2258416 | + | 56 | - | - | Antitoxin |
| RU53_RS15680 | 2258473..2258577 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| RU53_RS15690 | 2259257..2259415 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| RU53_RS11430 | 2260073..2260930 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
| RU53_RS11435 | 2260998..2261780 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T52782 WP_001802298.1 NZ_CP010526:c2258577-2258473 [Staphylococcus aureus subsp. aureus ST772-MRSA-V]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T52782 NZ_CP010526:c2258577-2258473 [Staphylococcus aureus subsp. aureus ST772-MRSA-V]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT52782 NZ_CP010526:2258361-2258416 [Staphylococcus aureus subsp. aureus ST772-MRSA-V]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|