Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1971611..1971791 | Replicon | chromosome |
Accession | NZ_CP010526 | ||
Organism | Staphylococcus aureus subsp. aureus ST772-MRSA-V strain DAR4145 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | RU53_RS16195 | Protein ID | WP_001801861.1 |
Coordinates | 1971611..1971706 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1971734..1971791 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RU53_RS09770 | 1967665..1968291 | + | 627 | WP_000669025.1 | hypothetical protein | - |
RU53_RS09775 | 1968318..1969061 | + | 744 | WP_174840254.1 | exotoxin | - |
RU53_RS09780 | 1969088..1969840 | + | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
RU53_RS09785 | 1969972..1970529 | - | 558 | WP_000864141.1 | ImmA/IrrE family metallo-endopeptidase | - |
RU53_RS09790 | 1970713..1971159 | - | 447 | WP_000747808.1 | DUF1433 domain-containing protein | - |
RU53_RS16195 | 1971611..1971706 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1971734..1971791 | - | 58 | - | - | Antitoxin |
RU53_RS09800 | 1972357..1974054 | - | 1698 | WP_000447924.1 | hypothetical protein | - |
RU53_RS09805 | 1974032..1974886 | - | 855 | WP_001069960.1 | DNA adenine methylase | - |
RU53_RS09810 | 1974925..1976190 | - | 1266 | WP_000072555.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 1965106..2002114 | 37008 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T52776 WP_001801861.1 NZ_CP010526:1971611-1971706 [Staphylococcus aureus subsp. aureus ST772-MRSA-V]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T52776 NZ_CP010526:1971611-1971706 [Staphylococcus aureus subsp. aureus ST772-MRSA-V]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT52776 NZ_CP010526:c1971791-1971734 [Staphylococcus aureus subsp. aureus ST772-MRSA-V]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|