Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2067805..2068027 Replicon chromosome
Accession NZ_CP010445
Organism Escherichia coli K-12 strain K-12 MG1655

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag SF31_RS10265 Protein ID WP_000170954.1
Coordinates 2067805..2067912 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2067960..2068027 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SF31_RS10235 2063114..2064196 + 1083 WP_000804726.1 peptide chain release factor 1 -
SF31_RS10240 2064196..2065029 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
SF31_RS10245 2065026..2065418 + 393 WP_000200374.1 invasion regulator SirB2 -
SF31_RS10250 2065422..2066231 + 810 WP_001257044.1 invasion regulator SirB1 -
SF31_RS10255 2066267..2067121 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
SF31_RS10260 2067270..2067377 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2067425..2067491 + 67 NuclAT_28 - -
- 2067425..2067491 + 67 NuclAT_28 - -
- 2067425..2067491 + 67 NuclAT_28 - -
- 2067425..2067491 + 67 NuclAT_28 - -
- 2067425..2067491 + 67 NuclAT_29 - -
- 2067425..2067491 + 67 NuclAT_29 - -
- 2067425..2067491 + 67 NuclAT_29 - -
- 2067425..2067491 + 67 NuclAT_29 - -
- 2067425..2067491 + 67 NuclAT_30 - -
- 2067425..2067491 + 67 NuclAT_30 - -
- 2067425..2067491 + 67 NuclAT_30 - -
- 2067425..2067491 + 67 NuclAT_30 - -
- 2067425..2067491 + 67 NuclAT_31 - -
- 2067425..2067491 + 67 NuclAT_31 - -
- 2067425..2067491 + 67 NuclAT_31 - -
- 2067425..2067491 + 67 NuclAT_31 - -
- 2067425..2067491 + 67 NuclAT_32 - -
- 2067425..2067491 + 67 NuclAT_32 - -
- 2067425..2067491 + 67 NuclAT_32 - -
- 2067425..2067491 + 67 NuclAT_32 - -
- 2067425..2067491 + 67 NuclAT_33 - -
- 2067425..2067491 + 67 NuclAT_33 - -
- 2067425..2067491 + 67 NuclAT_33 - -
- 2067425..2067491 + 67 NuclAT_33 - -
- 2067427..2067492 + 66 NuclAT_17 - -
- 2067427..2067492 + 66 NuclAT_17 - -
- 2067427..2067492 + 66 NuclAT_17 - -
- 2067427..2067492 + 66 NuclAT_17 - -
- 2067427..2067492 + 66 NuclAT_19 - -
- 2067427..2067492 + 66 NuclAT_19 - -
- 2067427..2067492 + 66 NuclAT_19 - -
- 2067427..2067492 + 66 NuclAT_19 - -
- 2067427..2067492 + 66 NuclAT_21 - -
- 2067427..2067492 + 66 NuclAT_21 - -
- 2067427..2067492 + 66 NuclAT_21 - -
- 2067427..2067492 + 66 NuclAT_21 - -
- 2067427..2067492 + 66 NuclAT_23 - -
- 2067427..2067492 + 66 NuclAT_23 - -
- 2067427..2067492 + 66 NuclAT_23 - -
- 2067427..2067492 + 66 NuclAT_23 - -
- 2067427..2067492 + 66 NuclAT_25 - -
- 2067427..2067492 + 66 NuclAT_25 - -
- 2067427..2067492 + 66 NuclAT_25 - -
- 2067427..2067492 + 66 NuclAT_25 - -
- 2067427..2067492 + 66 NuclAT_27 - -
- 2067427..2067492 + 66 NuclAT_27 - -
- 2067427..2067492 + 66 NuclAT_27 - -
- 2067427..2067492 + 66 NuclAT_27 - -
SF31_RS10265 2067805..2067912 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2067960..2068027 + 68 NuclAT_16 - Antitoxin
- 2067960..2068027 + 68 NuclAT_16 - Antitoxin
- 2067960..2068027 + 68 NuclAT_16 - Antitoxin
- 2067960..2068027 + 68 NuclAT_16 - Antitoxin
- 2067960..2068027 + 68 NuclAT_18 - Antitoxin
- 2067960..2068027 + 68 NuclAT_18 - Antitoxin
- 2067960..2068027 + 68 NuclAT_18 - Antitoxin
- 2067960..2068027 + 68 NuclAT_18 - Antitoxin
- 2067960..2068027 + 68 NuclAT_20 - Antitoxin
- 2067960..2068027 + 68 NuclAT_20 - Antitoxin
- 2067960..2068027 + 68 NuclAT_20 - Antitoxin
- 2067960..2068027 + 68 NuclAT_20 - Antitoxin
- 2067960..2068027 + 68 NuclAT_22 - Antitoxin
- 2067960..2068027 + 68 NuclAT_22 - Antitoxin
- 2067960..2068027 + 68 NuclAT_22 - Antitoxin
- 2067960..2068027 + 68 NuclAT_22 - Antitoxin
- 2067960..2068027 + 68 NuclAT_24 - Antitoxin
- 2067960..2068027 + 68 NuclAT_24 - Antitoxin
- 2067960..2068027 + 68 NuclAT_24 - Antitoxin
- 2067960..2068027 + 68 NuclAT_24 - Antitoxin
- 2067960..2068027 + 68 NuclAT_26 - Antitoxin
- 2067960..2068027 + 68 NuclAT_26 - Antitoxin
- 2067960..2068027 + 68 NuclAT_26 - Antitoxin
- 2067960..2068027 + 68 NuclAT_26 - Antitoxin
SF31_RS10270 2068316..2069416 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
SF31_RS10275 2069686..2069916 + 231 WP_001146444.1 putative cation transport regulator ChaB -
SF31_RS10280 2070074..2070769 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
SF31_RS10285 2070813..2071166 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
SF31_RS10290 2071351..2072745 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T52704 WP_000170954.1 NZ_CP010445:c2067912-2067805 [Escherichia coli K-12]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T52704 NZ_CP010445:c2067912-2067805 [Escherichia coli K-12]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT52704 NZ_CP010445:2067960-2068027 [Escherichia coli K-12]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9


Antitoxin

Download structure file

References