Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2014234..2014456 | Replicon | chromosome |
| Accession | NZ_CP010443 | ||
| Organism | Escherichia coli K-12 strain K-12 MG1655 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | SH04_RS09945 | Protein ID | WP_000170954.1 |
| Coordinates | 2014234..2014341 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2014389..2014456 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SH04_RS09915 | 2009543..2010625 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| SH04_RS09920 | 2010625..2011458 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| SH04_RS09925 | 2011455..2011847 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| SH04_RS09930 | 2011851..2012660 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| SH04_RS09935 | 2012696..2013550 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| SH04_RS09940 | 2013699..2013806 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 2013854..2013920 | + | 67 | NuclAT_28 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_28 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_28 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_28 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_29 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_29 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_29 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_29 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_30 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_30 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_30 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_30 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_31 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_31 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_31 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_31 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_32 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_32 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_32 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_32 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_33 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_33 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_33 | - | - |
| - | 2013854..2013920 | + | 67 | NuclAT_33 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_17 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_17 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_17 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_17 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_19 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_19 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_19 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_19 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_21 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_21 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_21 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_21 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_23 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_23 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_23 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_23 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_25 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_25 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_25 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_25 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_27 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_27 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_27 | - | - |
| - | 2013856..2013921 | + | 66 | NuclAT_27 | - | - |
| SH04_RS09945 | 2014234..2014341 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2014389..2014456 | + | 68 | NuclAT_16 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_16 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_16 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_16 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_18 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_18 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_18 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_18 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_22 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_22 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_22 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_22 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_24 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_24 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_24 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_24 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 2014389..2014456 | + | 68 | NuclAT_26 | - | Antitoxin |
| SH04_RS09950 | 2014745..2015845 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| SH04_RS09955 | 2016115..2016345 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| SH04_RS09960 | 2016503..2017198 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| SH04_RS09965 | 2017242..2017595 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| SH04_RS09970 | 2017780..2019174 | + | 1395 | WP_000086217.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T52621 WP_000170954.1 NZ_CP010443:c2014341-2014234 [Escherichia coli K-12]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T52621 NZ_CP010443:c2014341-2014234 [Escherichia coli K-12]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 bp
>AT52621 NZ_CP010443:2014389-2014456 [Escherichia coli K-12]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|