Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2067806..2068028 Replicon chromosome
Accession NZ_CP010442
Organism Escherichia coli K-12 strain K-12 MG1655

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag SH06_RS10265 Protein ID WP_000170954.1
Coordinates 2067806..2067913 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2067961..2068028 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SH06_RS10235 2063115..2064197 + 1083 WP_000804726.1 peptide chain release factor 1 -
SH06_RS10240 2064197..2065030 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
SH06_RS10245 2065027..2065419 + 393 WP_000200374.1 invasion regulator SirB2 -
SH06_RS10250 2065423..2066232 + 810 WP_001257044.1 invasion regulator SirB1 -
SH06_RS10255 2066268..2067122 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
SH06_RS10260 2067271..2067378 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2067426..2067492 + 67 NuclAT_28 - -
- 2067426..2067492 + 67 NuclAT_28 - -
- 2067426..2067492 + 67 NuclAT_28 - -
- 2067426..2067492 + 67 NuclAT_28 - -
- 2067426..2067492 + 67 NuclAT_29 - -
- 2067426..2067492 + 67 NuclAT_29 - -
- 2067426..2067492 + 67 NuclAT_29 - -
- 2067426..2067492 + 67 NuclAT_29 - -
- 2067426..2067492 + 67 NuclAT_30 - -
- 2067426..2067492 + 67 NuclAT_30 - -
- 2067426..2067492 + 67 NuclAT_30 - -
- 2067426..2067492 + 67 NuclAT_30 - -
- 2067426..2067492 + 67 NuclAT_31 - -
- 2067426..2067492 + 67 NuclAT_31 - -
- 2067426..2067492 + 67 NuclAT_31 - -
- 2067426..2067492 + 67 NuclAT_31 - -
- 2067426..2067492 + 67 NuclAT_32 - -
- 2067426..2067492 + 67 NuclAT_32 - -
- 2067426..2067492 + 67 NuclAT_32 - -
- 2067426..2067492 + 67 NuclAT_32 - -
- 2067426..2067492 + 67 NuclAT_33 - -
- 2067426..2067492 + 67 NuclAT_33 - -
- 2067426..2067492 + 67 NuclAT_33 - -
- 2067426..2067492 + 67 NuclAT_33 - -
- 2067428..2067493 + 66 NuclAT_17 - -
- 2067428..2067493 + 66 NuclAT_17 - -
- 2067428..2067493 + 66 NuclAT_17 - -
- 2067428..2067493 + 66 NuclAT_17 - -
- 2067428..2067493 + 66 NuclAT_19 - -
- 2067428..2067493 + 66 NuclAT_19 - -
- 2067428..2067493 + 66 NuclAT_19 - -
- 2067428..2067493 + 66 NuclAT_19 - -
- 2067428..2067493 + 66 NuclAT_21 - -
- 2067428..2067493 + 66 NuclAT_21 - -
- 2067428..2067493 + 66 NuclAT_21 - -
- 2067428..2067493 + 66 NuclAT_21 - -
- 2067428..2067493 + 66 NuclAT_23 - -
- 2067428..2067493 + 66 NuclAT_23 - -
- 2067428..2067493 + 66 NuclAT_23 - -
- 2067428..2067493 + 66 NuclAT_23 - -
- 2067428..2067493 + 66 NuclAT_25 - -
- 2067428..2067493 + 66 NuclAT_25 - -
- 2067428..2067493 + 66 NuclAT_25 - -
- 2067428..2067493 + 66 NuclAT_25 - -
- 2067428..2067493 + 66 NuclAT_27 - -
- 2067428..2067493 + 66 NuclAT_27 - -
- 2067428..2067493 + 66 NuclAT_27 - -
- 2067428..2067493 + 66 NuclAT_27 - -
SH06_RS10265 2067806..2067913 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2067961..2068028 + 68 NuclAT_16 - Antitoxin
- 2067961..2068028 + 68 NuclAT_16 - Antitoxin
- 2067961..2068028 + 68 NuclAT_16 - Antitoxin
- 2067961..2068028 + 68 NuclAT_16 - Antitoxin
- 2067961..2068028 + 68 NuclAT_18 - Antitoxin
- 2067961..2068028 + 68 NuclAT_18 - Antitoxin
- 2067961..2068028 + 68 NuclAT_18 - Antitoxin
- 2067961..2068028 + 68 NuclAT_18 - Antitoxin
- 2067961..2068028 + 68 NuclAT_20 - Antitoxin
- 2067961..2068028 + 68 NuclAT_20 - Antitoxin
- 2067961..2068028 + 68 NuclAT_20 - Antitoxin
- 2067961..2068028 + 68 NuclAT_20 - Antitoxin
- 2067961..2068028 + 68 NuclAT_22 - Antitoxin
- 2067961..2068028 + 68 NuclAT_22 - Antitoxin
- 2067961..2068028 + 68 NuclAT_22 - Antitoxin
- 2067961..2068028 + 68 NuclAT_22 - Antitoxin
- 2067961..2068028 + 68 NuclAT_24 - Antitoxin
- 2067961..2068028 + 68 NuclAT_24 - Antitoxin
- 2067961..2068028 + 68 NuclAT_24 - Antitoxin
- 2067961..2068028 + 68 NuclAT_24 - Antitoxin
- 2067961..2068028 + 68 NuclAT_26 - Antitoxin
- 2067961..2068028 + 68 NuclAT_26 - Antitoxin
- 2067961..2068028 + 68 NuclAT_26 - Antitoxin
- 2067961..2068028 + 68 NuclAT_26 - Antitoxin
SH06_RS10270 2068317..2069417 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
SH06_RS10275 2069687..2069917 + 231 WP_001146444.1 putative cation transport regulator ChaB -
SH06_RS10280 2070075..2070770 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
SH06_RS10285 2070814..2071167 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
SH06_RS10290 2071352..2072746 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T52580 WP_000170954.1 NZ_CP010442:c2067913-2067806 [Escherichia coli K-12]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T52580 NZ_CP010442:c2067913-2067806 [Escherichia coli K-12]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT52580 NZ_CP010442:2067961-2068028 [Escherichia coli K-12]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References