Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2026569..2026791 Replicon chromosome
Accession NZ_CP010438
Organism Escherichia coli K-12 strain K-12 MG1655

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag SH05_RS10050 Protein ID WP_000170963.1
Coordinates 2026569..2026676 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2026724..2026791 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SH05_RS10020 2021878..2022960 + 1083 WP_000804726.1 peptide chain release factor 1 -
SH05_RS10025 2022960..2023793 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
SH05_RS10030 2023790..2024182 + 393 WP_000200374.1 invasion regulator SirB2 -
SH05_RS10035 2024186..2024995 + 810 WP_001257044.1 invasion regulator SirB1 -
SH05_RS10040 2025031..2025885 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
SH05_RS10045 2026034..2026141 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2026189..2026255 + 67 NuclAT_34 - -
- 2026189..2026255 + 67 NuclAT_34 - -
- 2026189..2026255 + 67 NuclAT_34 - -
- 2026189..2026255 + 67 NuclAT_34 - -
- 2026189..2026255 + 67 NuclAT_36 - -
- 2026189..2026255 + 67 NuclAT_36 - -
- 2026189..2026255 + 67 NuclAT_36 - -
- 2026189..2026255 + 67 NuclAT_36 - -
- 2026189..2026255 + 67 NuclAT_38 - -
- 2026189..2026255 + 67 NuclAT_38 - -
- 2026189..2026255 + 67 NuclAT_38 - -
- 2026189..2026255 + 67 NuclAT_38 - -
- 2026189..2026255 + 67 NuclAT_40 - -
- 2026189..2026255 + 67 NuclAT_40 - -
- 2026189..2026255 + 67 NuclAT_40 - -
- 2026189..2026255 + 67 NuclAT_40 - -
- 2026189..2026255 + 67 NuclAT_42 - -
- 2026189..2026255 + 67 NuclAT_42 - -
- 2026189..2026255 + 67 NuclAT_42 - -
- 2026189..2026255 + 67 NuclAT_42 - -
- 2026189..2026255 + 67 NuclAT_44 - -
- 2026189..2026255 + 67 NuclAT_44 - -
- 2026189..2026255 + 67 NuclAT_44 - -
- 2026189..2026255 + 67 NuclAT_44 - -
- 2026191..2026256 + 66 NuclAT_18 - -
- 2026191..2026256 + 66 NuclAT_18 - -
- 2026191..2026256 + 66 NuclAT_18 - -
- 2026191..2026256 + 66 NuclAT_18 - -
- 2026191..2026256 + 66 NuclAT_21 - -
- 2026191..2026256 + 66 NuclAT_21 - -
- 2026191..2026256 + 66 NuclAT_21 - -
- 2026191..2026256 + 66 NuclAT_21 - -
- 2026191..2026256 + 66 NuclAT_24 - -
- 2026191..2026256 + 66 NuclAT_24 - -
- 2026191..2026256 + 66 NuclAT_24 - -
- 2026191..2026256 + 66 NuclAT_24 - -
- 2026191..2026256 + 66 NuclAT_27 - -
- 2026191..2026256 + 66 NuclAT_27 - -
- 2026191..2026256 + 66 NuclAT_27 - -
- 2026191..2026256 + 66 NuclAT_27 - -
- 2026191..2026256 + 66 NuclAT_30 - -
- 2026191..2026256 + 66 NuclAT_30 - -
- 2026191..2026256 + 66 NuclAT_30 - -
- 2026191..2026256 + 66 NuclAT_30 - -
- 2026191..2026256 + 66 NuclAT_33 - -
- 2026191..2026256 + 66 NuclAT_33 - -
- 2026191..2026256 + 66 NuclAT_33 - -
- 2026191..2026256 + 66 NuclAT_33 - -
SH05_RS10050 2026569..2026676 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 2026724..2026791 + 68 NuclAT_17 - Antitoxin
- 2026724..2026791 + 68 NuclAT_17 - Antitoxin
- 2026724..2026791 + 68 NuclAT_17 - Antitoxin
- 2026724..2026791 + 68 NuclAT_17 - Antitoxin
- 2026724..2026791 + 68 NuclAT_20 - Antitoxin
- 2026724..2026791 + 68 NuclAT_20 - Antitoxin
- 2026724..2026791 + 68 NuclAT_20 - Antitoxin
- 2026724..2026791 + 68 NuclAT_20 - Antitoxin
- 2026724..2026791 + 68 NuclAT_23 - Antitoxin
- 2026724..2026791 + 68 NuclAT_23 - Antitoxin
- 2026724..2026791 + 68 NuclAT_23 - Antitoxin
- 2026724..2026791 + 68 NuclAT_23 - Antitoxin
- 2026724..2026791 + 68 NuclAT_26 - Antitoxin
- 2026724..2026791 + 68 NuclAT_26 - Antitoxin
- 2026724..2026791 + 68 NuclAT_26 - Antitoxin
- 2026724..2026791 + 68 NuclAT_26 - Antitoxin
- 2026724..2026791 + 68 NuclAT_29 - Antitoxin
- 2026724..2026791 + 68 NuclAT_29 - Antitoxin
- 2026724..2026791 + 68 NuclAT_29 - Antitoxin
- 2026724..2026791 + 68 NuclAT_29 - Antitoxin
- 2026724..2026791 + 68 NuclAT_32 - Antitoxin
- 2026724..2026791 + 68 NuclAT_32 - Antitoxin
- 2026724..2026791 + 68 NuclAT_32 - Antitoxin
- 2026724..2026791 + 68 NuclAT_32 - Antitoxin
- 2026725..2026790 + 66 NuclAT_35 - -
- 2026725..2026790 + 66 NuclAT_35 - -
- 2026725..2026790 + 66 NuclAT_35 - -
- 2026725..2026790 + 66 NuclAT_35 - -
- 2026725..2026790 + 66 NuclAT_37 - -
- 2026725..2026790 + 66 NuclAT_37 - -
- 2026725..2026790 + 66 NuclAT_37 - -
- 2026725..2026790 + 66 NuclAT_37 - -
- 2026725..2026790 + 66 NuclAT_39 - -
- 2026725..2026790 + 66 NuclAT_39 - -
- 2026725..2026790 + 66 NuclAT_39 - -
- 2026725..2026790 + 66 NuclAT_39 - -
- 2026725..2026790 + 66 NuclAT_41 - -
- 2026725..2026790 + 66 NuclAT_41 - -
- 2026725..2026790 + 66 NuclAT_41 - -
- 2026725..2026790 + 66 NuclAT_41 - -
- 2026725..2026790 + 66 NuclAT_43 - -
- 2026725..2026790 + 66 NuclAT_43 - -
- 2026725..2026790 + 66 NuclAT_43 - -
- 2026725..2026790 + 66 NuclAT_43 - -
- 2026725..2026790 + 66 NuclAT_45 - -
- 2026725..2026790 + 66 NuclAT_45 - -
- 2026725..2026790 + 66 NuclAT_45 - -
- 2026725..2026790 + 66 NuclAT_45 - -
SH05_RS10055 2027104..2027211 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2027259..2027326 + 68 NuclAT_16 - -
- 2027259..2027326 + 68 NuclAT_16 - -
- 2027259..2027326 + 68 NuclAT_16 - -
- 2027259..2027326 + 68 NuclAT_16 - -
- 2027259..2027326 + 68 NuclAT_19 - -
- 2027259..2027326 + 68 NuclAT_19 - -
- 2027259..2027326 + 68 NuclAT_19 - -
- 2027259..2027326 + 68 NuclAT_19 - -
- 2027259..2027326 + 68 NuclAT_22 - -
- 2027259..2027326 + 68 NuclAT_22 - -
- 2027259..2027326 + 68 NuclAT_22 - -
- 2027259..2027326 + 68 NuclAT_22 - -
- 2027259..2027326 + 68 NuclAT_25 - -
- 2027259..2027326 + 68 NuclAT_25 - -
- 2027259..2027326 + 68 NuclAT_25 - -
- 2027259..2027326 + 68 NuclAT_25 - -
- 2027259..2027326 + 68 NuclAT_28 - -
- 2027259..2027326 + 68 NuclAT_28 - -
- 2027259..2027326 + 68 NuclAT_28 - -
- 2027259..2027326 + 68 NuclAT_28 - -
- 2027259..2027326 + 68 NuclAT_31 - -
- 2027259..2027326 + 68 NuclAT_31 - -
- 2027259..2027326 + 68 NuclAT_31 - -
- 2027259..2027326 + 68 NuclAT_31 - -
SH05_RS10060 2027615..2028715 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
SH05_RS10065 2028985..2029215 + 231 WP_001146444.1 putative cation transport regulator ChaB -
SH05_RS10070 2029373..2030068 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
SH05_RS10075 2030112..2030465 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T52424 WP_000170963.1 NZ_CP010438:c2026676-2026569 [Escherichia coli K-12]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T52424 NZ_CP010438:c2026676-2026569 [Escherichia coli K-12]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT52424 NZ_CP010438:2026724-2026791 [Escherichia coli K-12]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References