Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2026569..2026791 | Replicon | chromosome |
| Accession | NZ_CP010438 | ||
| Organism | Escherichia coli K-12 strain K-12 MG1655 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | SH05_RS10050 | Protein ID | WP_000170963.1 |
| Coordinates | 2026569..2026676 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2026724..2026791 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SH05_RS10020 | 2021878..2022960 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| SH05_RS10025 | 2022960..2023793 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| SH05_RS10030 | 2023790..2024182 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| SH05_RS10035 | 2024186..2024995 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| SH05_RS10040 | 2025031..2025885 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| SH05_RS10045 | 2026034..2026141 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 2026189..2026255 | + | 67 | NuclAT_34 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_34 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_34 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_34 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_36 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_36 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_36 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_36 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_38 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_38 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_38 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_38 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_40 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_40 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_40 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_40 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_42 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_42 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_42 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_42 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_44 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_44 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_44 | - | - |
| - | 2026189..2026255 | + | 67 | NuclAT_44 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_18 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_18 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_18 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_18 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_21 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_21 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_21 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_21 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_24 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_24 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_24 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_24 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_27 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_27 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_27 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_27 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_30 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_30 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_30 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_30 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_33 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_33 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_33 | - | - |
| - | 2026191..2026256 | + | 66 | NuclAT_33 | - | - |
| SH05_RS10050 | 2026569..2026676 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | Toxin |
| - | 2026724..2026791 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_29 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_29 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_29 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_29 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_32 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_32 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_32 | - | Antitoxin |
| - | 2026724..2026791 | + | 68 | NuclAT_32 | - | Antitoxin |
| - | 2026725..2026790 | + | 66 | NuclAT_35 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_35 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_35 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_35 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_37 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_37 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_37 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_37 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_39 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_39 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_39 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_39 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_41 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_41 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_41 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_41 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_43 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_43 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_43 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_43 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_45 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_45 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_45 | - | - |
| - | 2026725..2026790 | + | 66 | NuclAT_45 | - | - |
| SH05_RS10055 | 2027104..2027211 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 2027259..2027326 | + | 68 | NuclAT_16 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_16 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_16 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_16 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_19 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_19 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_19 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_19 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_22 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_22 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_22 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_22 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_25 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_25 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_25 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_25 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_28 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_28 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_28 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_28 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_31 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_31 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_31 | - | - |
| - | 2027259..2027326 | + | 68 | NuclAT_31 | - | - |
| SH05_RS10060 | 2027615..2028715 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| SH05_RS10065 | 2028985..2029215 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| SH05_RS10070 | 2029373..2030068 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| SH05_RS10075 | 2030112..2030465 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T52424 WP_000170963.1 NZ_CP010438:c2026676-2026569 [Escherichia coli K-12]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T52424 NZ_CP010438:c2026676-2026569 [Escherichia coli K-12]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 bp
>AT52424 NZ_CP010438:2026724-2026791 [Escherichia coli K-12]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|