Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2195744..2195961 | Replicon | chromosome |
Accession | NZ_CP010402 | ||
Organism | Staphylococcus aureus strain GR2 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | RT44_RS11135 | Protein ID | WP_001802298.1 |
Coordinates | 2195857..2195961 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2195744..2195799 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RT44_RS11115 | 2191881..2192546 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
RT44_RS11120 | 2192698..2193018 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
RT44_RS11125 | 2193020..2194000 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
RT44_RS11130 | 2194266..2195357 | + | 1092 | WP_000495670.1 | lytic regulatory protein | - |
- | 2195744..2195799 | + | 56 | - | - | Antitoxin |
RT44_RS11135 | 2195857..2195961 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
RT44_RS14835 | 2196641..2196799 | + | 159 | WP_001792784.1 | hypothetical protein | - |
RT44_RS11140 | 2197457..2198314 | - | 858 | WP_000370929.1 | Cof-type HAD-IIB family hydrolase | - |
RT44_RS11145 | 2198382..2199164 | - | 783 | WP_000908179.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T52356 WP_001802298.1 NZ_CP010402:c2195961-2195857 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T52356 NZ_CP010402:c2195961-2195857 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT52356 NZ_CP010402:2195744-2195799 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|