Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2021805..2022104 | Replicon | chromosome |
Accession | NZ_CP010402 | ||
Organism | Staphylococcus aureus strain GR2 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | RT44_RS14775 | Protein ID | WP_072353918.1 |
Coordinates | 2021928..2022104 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2021805..2021860 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RT44_RS10105 | 2017363..2017542 | + | 180 | WP_000669791.1 | hypothetical protein | - |
RT44_RS10115 | 2017853..2018113 | + | 261 | WP_001791826.1 | hypothetical protein | - |
RT44_RS10120 | 2018166..2018516 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
RT44_RS10125 | 2019027..2019362 | - | 336 | Protein_1910 | SH3 domain-containing protein | - |
RT44_RS10130 | 2020013..2020504 | - | 492 | WP_000920038.1 | staphylokinase | - |
RT44_RS10135 | 2020695..2021450 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
RT44_RS10140 | 2021462..2021716 | - | 255 | WP_000611512.1 | phage holin | - |
RT44_RS10145 | 2021768..2021875 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2021797..2021936 | + | 140 | NuclAT_0 | - | - |
- | 2021797..2021936 | + | 140 | NuclAT_0 | - | - |
- | 2021797..2021936 | + | 140 | NuclAT_0 | - | - |
- | 2021797..2021936 | + | 140 | NuclAT_0 | - | - |
- | 2021805..2021860 | + | 56 | - | - | Antitoxin |
RT44_RS14775 | 2021928..2022104 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
RT44_RS10150 | 2022247..2022621 | - | 375 | WP_000340977.1 | hypothetical protein | - |
RT44_RS10155 | 2022677..2022964 | - | 288 | WP_001262620.1 | hypothetical protein | - |
RT44_RS10160 | 2023010..2023162 | - | 153 | WP_001000058.1 | hypothetical protein | - |
RT44_RS15115 | 2023155..2026937 | - | 3783 | Protein_1919 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 2018166..2069859 | 51693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T52349 WP_072353918.1 NZ_CP010402:c2022104-2021928 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T52349 NZ_CP010402:c2022104-2021928 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT52349 NZ_CP010402:2021805-2021860 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|