Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1322360..1322581 Replicon chromosome
Accession NZ_CP010344
Organism Escherichia coli ECC-1470

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag E1470_RS06500 Protein ID WP_000170954.1
Coordinates 1322360..1322467 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1322515..1322581 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E1470_RS06475 1318204..1319286 + 1083 WP_000804726.1 peptide chain release factor 1 -
E1470_RS06480 1319286..1320119 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
E1470_RS06485 1320116..1320508 + 393 WP_000200378.1 invasion regulator SirB2 -
E1470_RS06490 1320512..1321321 + 810 WP_001257044.1 invasion regulator SirB1 -
E1470_RS06495 1321357..1322211 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
E1470_RS06500 1322360..1322467 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1322515..1322581 + 67 NuclAT_27 - Antitoxin
- 1322515..1322581 + 67 NuclAT_27 - Antitoxin
- 1322515..1322581 + 67 NuclAT_27 - Antitoxin
- 1322515..1322581 + 67 NuclAT_27 - Antitoxin
- 1322515..1322581 + 67 NuclAT_29 - Antitoxin
- 1322515..1322581 + 67 NuclAT_29 - Antitoxin
- 1322515..1322581 + 67 NuclAT_29 - Antitoxin
- 1322515..1322581 + 67 NuclAT_29 - Antitoxin
- 1322515..1322581 + 67 NuclAT_31 - Antitoxin
- 1322515..1322581 + 67 NuclAT_31 - Antitoxin
- 1322515..1322581 + 67 NuclAT_31 - Antitoxin
- 1322515..1322581 + 67 NuclAT_31 - Antitoxin
- 1322515..1322581 + 67 NuclAT_33 - Antitoxin
- 1322515..1322581 + 67 NuclAT_33 - Antitoxin
- 1322515..1322581 + 67 NuclAT_33 - Antitoxin
- 1322515..1322581 + 67 NuclAT_33 - Antitoxin
- 1322515..1322581 + 67 NuclAT_35 - Antitoxin
- 1322515..1322581 + 67 NuclAT_35 - Antitoxin
- 1322515..1322581 + 67 NuclAT_35 - Antitoxin
- 1322515..1322581 + 67 NuclAT_35 - Antitoxin
- 1322515..1322581 + 67 NuclAT_37 - Antitoxin
- 1322515..1322581 + 67 NuclAT_37 - Antitoxin
- 1322515..1322581 + 67 NuclAT_37 - Antitoxin
- 1322515..1322581 + 67 NuclAT_37 - Antitoxin
- 1322517..1322580 + 64 NuclAT_40 - -
- 1322517..1322580 + 64 NuclAT_40 - -
- 1322517..1322580 + 64 NuclAT_40 - -
- 1322517..1322580 + 64 NuclAT_40 - -
- 1322517..1322580 + 64 NuclAT_42 - -
- 1322517..1322580 + 64 NuclAT_42 - -
- 1322517..1322580 + 64 NuclAT_42 - -
- 1322517..1322580 + 64 NuclAT_42 - -
- 1322517..1322580 + 64 NuclAT_44 - -
- 1322517..1322580 + 64 NuclAT_44 - -
- 1322517..1322580 + 64 NuclAT_44 - -
- 1322517..1322580 + 64 NuclAT_44 - -
E1470_RS26980 1322895..1323002 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1323055..1323116 + 62 NuclAT_39 - -
- 1323055..1323116 + 62 NuclAT_39 - -
- 1323055..1323116 + 62 NuclAT_39 - -
- 1323055..1323116 + 62 NuclAT_39 - -
- 1323055..1323116 + 62 NuclAT_41 - -
- 1323055..1323116 + 62 NuclAT_41 - -
- 1323055..1323116 + 62 NuclAT_41 - -
- 1323055..1323116 + 62 NuclAT_41 - -
- 1323055..1323116 + 62 NuclAT_43 - -
- 1323055..1323116 + 62 NuclAT_43 - -
- 1323055..1323116 + 62 NuclAT_43 - -
- 1323055..1323116 + 62 NuclAT_43 - -
- 1323055..1323117 + 63 NuclAT_28 - -
- 1323055..1323117 + 63 NuclAT_28 - -
- 1323055..1323117 + 63 NuclAT_28 - -
- 1323055..1323117 + 63 NuclAT_28 - -
- 1323055..1323117 + 63 NuclAT_30 - -
- 1323055..1323117 + 63 NuclAT_30 - -
- 1323055..1323117 + 63 NuclAT_30 - -
- 1323055..1323117 + 63 NuclAT_30 - -
- 1323055..1323117 + 63 NuclAT_32 - -
- 1323055..1323117 + 63 NuclAT_32 - -
- 1323055..1323117 + 63 NuclAT_32 - -
- 1323055..1323117 + 63 NuclAT_32 - -
- 1323055..1323117 + 63 NuclAT_34 - -
- 1323055..1323117 + 63 NuclAT_34 - -
- 1323055..1323117 + 63 NuclAT_34 - -
- 1323055..1323117 + 63 NuclAT_34 - -
- 1323055..1323117 + 63 NuclAT_36 - -
- 1323055..1323117 + 63 NuclAT_36 - -
- 1323055..1323117 + 63 NuclAT_36 - -
- 1323055..1323117 + 63 NuclAT_36 - -
- 1323055..1323117 + 63 NuclAT_38 - -
- 1323055..1323117 + 63 NuclAT_38 - -
- 1323055..1323117 + 63 NuclAT_38 - -
- 1323055..1323117 + 63 NuclAT_38 - -
- 1323055..1323118 + 64 NuclAT_16 - -
- 1323055..1323118 + 64 NuclAT_16 - -
- 1323055..1323118 + 64 NuclAT_16 - -
- 1323055..1323118 + 64 NuclAT_16 - -
- 1323055..1323118 + 64 NuclAT_18 - -
- 1323055..1323118 + 64 NuclAT_18 - -
- 1323055..1323118 + 64 NuclAT_18 - -
- 1323055..1323118 + 64 NuclAT_18 - -
- 1323055..1323118 + 64 NuclAT_20 - -
- 1323055..1323118 + 64 NuclAT_20 - -
- 1323055..1323118 + 64 NuclAT_20 - -
- 1323055..1323118 + 64 NuclAT_20 - -
- 1323055..1323118 + 64 NuclAT_22 - -
- 1323055..1323118 + 64 NuclAT_22 - -
- 1323055..1323118 + 64 NuclAT_22 - -
- 1323055..1323118 + 64 NuclAT_22 - -
- 1323055..1323118 + 64 NuclAT_24 - -
- 1323055..1323118 + 64 NuclAT_24 - -
- 1323055..1323118 + 64 NuclAT_24 - -
- 1323055..1323118 + 64 NuclAT_24 - -
- 1323055..1323118 + 64 NuclAT_26 - -
- 1323055..1323118 + 64 NuclAT_26 - -
- 1323055..1323118 + 64 NuclAT_26 - -
- 1323055..1323118 + 64 NuclAT_26 - -
E1470_RS06510 1323431..1323538 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1323586..1323653 + 68 NuclAT_15 - -
- 1323586..1323653 + 68 NuclAT_15 - -
- 1323586..1323653 + 68 NuclAT_15 - -
- 1323586..1323653 + 68 NuclAT_15 - -
- 1323586..1323653 + 68 NuclAT_17 - -
- 1323586..1323653 + 68 NuclAT_17 - -
- 1323586..1323653 + 68 NuclAT_17 - -
- 1323586..1323653 + 68 NuclAT_17 - -
- 1323586..1323653 + 68 NuclAT_19 - -
- 1323586..1323653 + 68 NuclAT_19 - -
- 1323586..1323653 + 68 NuclAT_19 - -
- 1323586..1323653 + 68 NuclAT_19 - -
- 1323586..1323653 + 68 NuclAT_21 - -
- 1323586..1323653 + 68 NuclAT_21 - -
- 1323586..1323653 + 68 NuclAT_21 - -
- 1323586..1323653 + 68 NuclAT_21 - -
- 1323586..1323653 + 68 NuclAT_23 - -
- 1323586..1323653 + 68 NuclAT_23 - -
- 1323586..1323653 + 68 NuclAT_23 - -
- 1323586..1323653 + 68 NuclAT_23 - -
- 1323586..1323653 + 68 NuclAT_25 - -
- 1323586..1323653 + 68 NuclAT_25 - -
- 1323586..1323653 + 68 NuclAT_25 - -
- 1323586..1323653 + 68 NuclAT_25 - -
E1470_RS06515 1323943..1325043 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
E1470_RS06520 1325313..1325543 + 231 WP_001146442.1 putative cation transport regulator ChaB -
E1470_RS06525 1325701..1326396 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
E1470_RS06530 1326440..1326793 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T52177 WP_000170954.1 NZ_CP010344:c1322467-1322360 [Escherichia coli ECC-1470]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T52177 NZ_CP010344:c1322467-1322360 [Escherichia coli ECC-1470]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT52177 NZ_CP010344:1322515-1322581 [Escherichia coli ECC-1470]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References