Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 4461774..4461995 | Replicon | chromosome |
| Accession | NZ_CP010304 | ||
| Organism | Escherichia coli O157:H7 str. SS52 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | SS52_RS32215 | Protein ID | WP_001295224.1 |
| Coordinates | 4461774..4461881 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 4461930..4461995 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SS52_RS23240 | 4457027..4457779 | - | 753 | Protein_4384 | cellulose biosynthesis protein BcsQ | - |
| SS52_RS23250 | 4457791..4457979 | - | 189 | WP_001063316.1 | YhjR family protein | - |
| SS52_RS23255 | 4458252..4459823 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
| SS52_RS23260 | 4459820..4460011 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| SS52_RS23265 | 4460008..4461687 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| SS52_RS32215 | 4461774..4461881 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4461930..4461995 | + | 66 | NuclAT_16 | - | Antitoxin |
| - | 4461930..4461995 | + | 66 | NuclAT_16 | - | Antitoxin |
| - | 4461930..4461995 | + | 66 | NuclAT_16 | - | Antitoxin |
| - | 4461930..4461995 | + | 66 | NuclAT_16 | - | Antitoxin |
| - | 4461930..4461995 | + | 66 | NuclAT_21 | - | Antitoxin |
| - | 4461930..4461995 | + | 66 | NuclAT_21 | - | Antitoxin |
| - | 4461930..4461995 | + | 66 | NuclAT_21 | - | Antitoxin |
| - | 4461930..4461995 | + | 66 | NuclAT_21 | - | Antitoxin |
| SS52_RS23280 | 4462357..4463628 | + | 1272 | WP_001301684.1 | amino acid permease | - |
| SS52_RS23285 | 4463658..4464662 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| SS52_RS23290 | 4464659..4465642 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| SS52_RS23295 | 4465653..4466555 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T51967 WP_001295224.1 NZ_CP010304:c4461881-4461774 [Escherichia coli O157:H7 str. SS52]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T51967 NZ_CP010304:c4461881-4461774 [Escherichia coli O157:H7 str. SS52]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT51967 NZ_CP010304:4461930-4461995 [Escherichia coli O157:H7 str. SS52]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|