Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1929116..1929298 | Replicon | chromosome |
| Accession | NZ_CP010299 | ||
| Organism | Staphylococcus aureus strain ATCC BAA1680 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RM27_RS15410 | Protein ID | WP_144245636.1 |
| Coordinates | 1929116..1929211 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1929239..1929298 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RM27_RS15550 | 1924362..1924700 | + | 339 | WP_173401752.1 | hypothetical protein | - |
| RM27_RS08835 | 1924776..1925402 | + | 627 | Protein_1842 | hypothetical protein | - |
| RM27_RS08840 | 1925443..1925787 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| RM27_RS08845 | 1925885..1926436 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| RM27_RS08850 | 1926654..1927295 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RM27_RS08855 | 1927409..1927594 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| RM27_RS14555 | 1927596..1927772 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| RM27_RS08865 | 1927783..1928166 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| RM27_RS14565 | 1928770..1928913 | - | 144 | WP_001549059.1 | transposase | - |
| RM27_RS15410 | 1929116..1929211 | + | 96 | WP_144245636.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 1929239..1929298 | - | 60 | - | - | Antitoxin |
| RM27_RS14570 | 1929334..1929435 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| RM27_RS14575 | 1929413..1929589 | - | 177 | Protein_1852 | transposase | - |
| RM27_RS08875 | 1929783..1930160 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1922215..1947818 | 25603 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T51901 WP_144245636.1 NZ_CP010299:1929116-1929211 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T51901 NZ_CP010299:1929116-1929211 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT51901 NZ_CP010299:c1929298-1929239 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|