Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2090215..2090514 | Replicon | chromosome |
Accession | NZ_CP010297 | ||
Organism | Staphylococcus aureus strain ATCC BAA1680 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | QT38_RS14750 | Protein ID | WP_011447039.1 |
Coordinates | 2090338..2090514 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2090215..2090270 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QT38_RS14725 | 2085546..2085806 | + | 261 | WP_001791826.1 | hypothetical protein | - |
QT38_RS09725 | 2085859..2086209 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
QT38_RS09730 | 2086894..2087343 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
QT38_RS15420 | 2087438..2087773 | - | 336 | Protein_2002 | SH3 domain-containing protein | - |
QT38_RS09740 | 2088423..2088914 | - | 492 | WP_000919350.1 | staphylokinase | - |
QT38_RS09745 | 2089105..2089860 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
QT38_RS09750 | 2089872..2090126 | - | 255 | WP_000611512.1 | phage holin | - |
QT38_RS14745 | 2090178..2090285 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2090207..2090346 | + | 140 | NuclAT_0 | - | - |
- | 2090207..2090346 | + | 140 | NuclAT_0 | - | - |
- | 2090207..2090346 | + | 140 | NuclAT_0 | - | - |
- | 2090207..2090346 | + | 140 | NuclAT_0 | - | - |
- | 2090215..2090270 | + | 56 | - | - | Antitoxin |
QT38_RS14750 | 2090338..2090514 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
QT38_RS09760 | 2090664..2090960 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
QT38_RS09765 | 2091018..2091305 | - | 288 | WP_001040261.1 | hypothetical protein | - |
QT38_RS14755 | 2091352..2091504 | - | 153 | WP_001153681.1 | hypothetical protein | - |
QT38_RS09775 | 2091494..2095279 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2085859..2144826 | 58967 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T51872 WP_011447039.1 NZ_CP010297:c2090514-2090338 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T51872 NZ_CP010297:c2090514-2090338 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT51872 NZ_CP010297:2090215-2090270 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|