Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1929116..1929298 | Replicon | chromosome |
Accession | NZ_CP010296 | ||
Organism | Staphylococcus aureus strain ATCC BAA1680 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | RM30_RS15405 | Protein ID | WP_144245636.1 |
Coordinates | 1929116..1929211 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1929239..1929298 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RM30_RS15545 | 1924362..1924700 | + | 339 | WP_173401752.1 | hypothetical protein | - |
RM30_RS08835 | 1924776..1925402 | + | 627 | Protein_1842 | hypothetical protein | - |
RM30_RS08840 | 1925443..1925787 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
RM30_RS08845 | 1925885..1926436 | + | 552 | WP_000414205.1 | hypothetical protein | - |
RM30_RS08850 | 1926654..1927295 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
RM30_RS08855 | 1927409..1927594 | - | 186 | WP_000809857.1 | hypothetical protein | - |
RM30_RS14540 | 1927596..1927772 | - | 177 | WP_000375476.1 | hypothetical protein | - |
RM30_RS08865 | 1927783..1928166 | - | 384 | WP_000070811.1 | hypothetical protein | - |
RM30_RS14550 | 1928770..1928913 | - | 144 | WP_001549059.1 | transposase | - |
RM30_RS15405 | 1929116..1929211 | + | 96 | WP_144245636.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1929239..1929298 | - | 60 | - | - | Antitoxin |
RM30_RS14555 | 1929334..1929435 | + | 102 | WP_001791893.1 | hypothetical protein | - |
RM30_RS14560 | 1929413..1929589 | - | 177 | Protein_1852 | transposase | - |
RM30_RS08875 | 1929783..1930160 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1891675..1977699 | 86024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T51853 WP_144245636.1 NZ_CP010296:1929116-1929211 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T51853 NZ_CP010296:1929116-1929211 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT51853 NZ_CP010296:c1929298-1929239 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|