Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3188083..3188303 Replicon chromosome
Accession NZ_CP010240
Organism Escherichia coli strain C7

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag RG29_RS16840 Protein ID WP_000170965.1
Coordinates 3188083..3188190 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3188237..3188303 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG29_RS16800 3183938..3184771 + 834 WP_000456459.1 peptide chain release factor N(5)-glutamine methyltransferase -
RG29_RS16805 3184768..3185160 + 393 WP_000200392.1 invasion regulator SirB2 -
RG29_RS16810 3185164..3185973 + 810 WP_001257044.1 invasion regulator SirB1 -
RG29_RS16815 3186009..3186863 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
RG29_RS16820 3187012..3187119 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3187167..3187233 + 67 NuclAT_44 - -
- 3187167..3187233 + 67 NuclAT_44 - -
- 3187167..3187233 + 67 NuclAT_44 - -
- 3187167..3187233 + 67 NuclAT_44 - -
- 3187167..3187233 + 67 NuclAT_47 - -
- 3187167..3187233 + 67 NuclAT_47 - -
- 3187167..3187233 + 67 NuclAT_47 - -
- 3187167..3187233 + 67 NuclAT_47 - -
- 3187169..3187232 + 64 NuclAT_16 - -
- 3187169..3187232 + 64 NuclAT_16 - -
- 3187169..3187232 + 64 NuclAT_16 - -
- 3187169..3187232 + 64 NuclAT_16 - -
- 3187169..3187232 + 64 NuclAT_19 - -
- 3187169..3187232 + 64 NuclAT_19 - -
- 3187169..3187232 + 64 NuclAT_19 - -
- 3187169..3187232 + 64 NuclAT_19 - -
- 3187169..3187232 + 64 NuclAT_22 - -
- 3187169..3187232 + 64 NuclAT_22 - -
- 3187169..3187232 + 64 NuclAT_22 - -
- 3187169..3187232 + 64 NuclAT_22 - -
- 3187169..3187232 + 64 NuclAT_25 - -
- 3187169..3187232 + 64 NuclAT_25 - -
- 3187169..3187232 + 64 NuclAT_25 - -
- 3187169..3187232 + 64 NuclAT_25 - -
- 3187169..3187232 + 64 NuclAT_28 - -
- 3187169..3187232 + 64 NuclAT_28 - -
- 3187169..3187232 + 64 NuclAT_28 - -
- 3187169..3187232 + 64 NuclAT_28 - -
- 3187169..3187232 + 64 NuclAT_31 - -
- 3187169..3187232 + 64 NuclAT_31 - -
- 3187169..3187232 + 64 NuclAT_31 - -
- 3187169..3187232 + 64 NuclAT_31 - -
RG29_RS29985 3187547..3187654 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3187707..3187768 + 62 NuclAT_15 - -
- 3187707..3187768 + 62 NuclAT_15 - -
- 3187707..3187768 + 62 NuclAT_15 - -
- 3187707..3187768 + 62 NuclAT_15 - -
- 3187707..3187768 + 62 NuclAT_18 - -
- 3187707..3187768 + 62 NuclAT_18 - -
- 3187707..3187768 + 62 NuclAT_18 - -
- 3187707..3187768 + 62 NuclAT_18 - -
- 3187707..3187768 + 62 NuclAT_21 - -
- 3187707..3187768 + 62 NuclAT_21 - -
- 3187707..3187768 + 62 NuclAT_21 - -
- 3187707..3187768 + 62 NuclAT_21 - -
- 3187707..3187768 + 62 NuclAT_24 - -
- 3187707..3187768 + 62 NuclAT_24 - -
- 3187707..3187768 + 62 NuclAT_24 - -
- 3187707..3187768 + 62 NuclAT_24 - -
- 3187707..3187768 + 62 NuclAT_27 - -
- 3187707..3187768 + 62 NuclAT_27 - -
- 3187707..3187768 + 62 NuclAT_27 - -
- 3187707..3187768 + 62 NuclAT_27 - -
- 3187707..3187768 + 62 NuclAT_30 - -
- 3187707..3187768 + 62 NuclAT_30 - -
- 3187707..3187768 + 62 NuclAT_30 - -
- 3187707..3187768 + 62 NuclAT_30 - -
- 3187707..3187769 + 63 NuclAT_45 - -
- 3187707..3187769 + 63 NuclAT_45 - -
- 3187707..3187769 + 63 NuclAT_45 - -
- 3187707..3187769 + 63 NuclAT_45 - -
- 3187707..3187769 + 63 NuclAT_48 - -
- 3187707..3187769 + 63 NuclAT_48 - -
- 3187707..3187769 + 63 NuclAT_48 - -
- 3187707..3187769 + 63 NuclAT_48 - -
- 3187707..3187770 + 64 NuclAT_33 - -
- 3187707..3187770 + 64 NuclAT_33 - -
- 3187707..3187770 + 64 NuclAT_33 - -
- 3187707..3187770 + 64 NuclAT_33 - -
- 3187707..3187770 + 64 NuclAT_35 - -
- 3187707..3187770 + 64 NuclAT_35 - -
- 3187707..3187770 + 64 NuclAT_35 - -
- 3187707..3187770 + 64 NuclAT_35 - -
- 3187707..3187770 + 64 NuclAT_37 - -
- 3187707..3187770 + 64 NuclAT_37 - -
- 3187707..3187770 + 64 NuclAT_37 - -
- 3187707..3187770 + 64 NuclAT_37 - -
- 3187707..3187770 + 64 NuclAT_39 - -
- 3187707..3187770 + 64 NuclAT_39 - -
- 3187707..3187770 + 64 NuclAT_39 - -
- 3187707..3187770 + 64 NuclAT_39 - -
- 3187707..3187770 + 64 NuclAT_41 - -
- 3187707..3187770 + 64 NuclAT_41 - -
- 3187707..3187770 + 64 NuclAT_41 - -
- 3187707..3187770 + 64 NuclAT_41 - -
- 3187707..3187770 + 64 NuclAT_43 - -
- 3187707..3187770 + 64 NuclAT_43 - -
- 3187707..3187770 + 64 NuclAT_43 - -
- 3187707..3187770 + 64 NuclAT_43 - -
RG29_RS16840 3188083..3188190 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3188237..3188303 + 67 - - Antitoxin
RG29_RS16850 3188595..3189695 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
RG29_RS16855 3189965..3190195 + 231 WP_001146442.1 putative cation transport regulator ChaB -
RG29_RS16860 3190353..3191048 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
RG29_RS16865 3191092..3191445 - 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -
RG29_RS16870 3191630..3193024 + 1395 WP_000086212.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T51732 WP_000170965.1 NZ_CP010240:c3188190-3188083 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T51732 NZ_CP010240:c3188190-3188083 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT51732 NZ_CP010240:3188237-3188303 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References