Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3188083..3188303 | Replicon | chromosome |
| Accession | NZ_CP010240 | ||
| Organism | Escherichia coli strain C7 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | RG29_RS16840 | Protein ID | WP_000170965.1 |
| Coordinates | 3188083..3188190 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3188237..3188303 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG29_RS16800 | 3183938..3184771 | + | 834 | WP_000456459.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| RG29_RS16805 | 3184768..3185160 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| RG29_RS16810 | 3185164..3185973 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| RG29_RS16815 | 3186009..3186863 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| RG29_RS16820 | 3187012..3187119 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 3187167..3187233 | + | 67 | NuclAT_44 | - | - |
| - | 3187167..3187233 | + | 67 | NuclAT_44 | - | - |
| - | 3187167..3187233 | + | 67 | NuclAT_44 | - | - |
| - | 3187167..3187233 | + | 67 | NuclAT_44 | - | - |
| - | 3187167..3187233 | + | 67 | NuclAT_47 | - | - |
| - | 3187167..3187233 | + | 67 | NuclAT_47 | - | - |
| - | 3187167..3187233 | + | 67 | NuclAT_47 | - | - |
| - | 3187167..3187233 | + | 67 | NuclAT_47 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_16 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_16 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_16 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_16 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_19 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_19 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_19 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_19 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_22 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_22 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_22 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_22 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_25 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_25 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_25 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_25 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_28 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_28 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_28 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_28 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_31 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_31 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_31 | - | - |
| - | 3187169..3187232 | + | 64 | NuclAT_31 | - | - |
| RG29_RS29985 | 3187547..3187654 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 3187707..3187768 | + | 62 | NuclAT_15 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_15 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_15 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_15 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_18 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_18 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_18 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_18 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_21 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_21 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_21 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_21 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_24 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_24 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_24 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_24 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_27 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_27 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_27 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_27 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_30 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_30 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_30 | - | - |
| - | 3187707..3187768 | + | 62 | NuclAT_30 | - | - |
| - | 3187707..3187769 | + | 63 | NuclAT_45 | - | - |
| - | 3187707..3187769 | + | 63 | NuclAT_45 | - | - |
| - | 3187707..3187769 | + | 63 | NuclAT_45 | - | - |
| - | 3187707..3187769 | + | 63 | NuclAT_45 | - | - |
| - | 3187707..3187769 | + | 63 | NuclAT_48 | - | - |
| - | 3187707..3187769 | + | 63 | NuclAT_48 | - | - |
| - | 3187707..3187769 | + | 63 | NuclAT_48 | - | - |
| - | 3187707..3187769 | + | 63 | NuclAT_48 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_33 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_33 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_33 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_33 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_35 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_35 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_35 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_35 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_37 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_37 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_37 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_37 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_39 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_39 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_39 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_39 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_41 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_41 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_41 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_41 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_43 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_43 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_43 | - | - |
| - | 3187707..3187770 | + | 64 | NuclAT_43 | - | - |
| RG29_RS16840 | 3188083..3188190 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 3188237..3188303 | + | 67 | - | - | Antitoxin |
| RG29_RS16850 | 3188595..3189695 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| RG29_RS16855 | 3189965..3190195 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| RG29_RS16860 | 3190353..3191048 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| RG29_RS16865 | 3191092..3191445 | - | 354 | WP_001169666.1 | DsrE/F sulfur relay family protein YchN | - |
| RG29_RS16870 | 3191630..3193024 | + | 1395 | WP_000086212.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T51732 WP_000170965.1 NZ_CP010240:c3188190-3188083 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T51732 NZ_CP010240:c3188190-3188083 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT51732 NZ_CP010240:3188237-3188303 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|