Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 3187547..3187768 Replicon chromosome
Accession NZ_CP010240
Organism Escherichia coli strain C7

Toxin (Protein)


Gene name ldrD Uniprot ID E0IV43
Locus tag RG29_RS29985 Protein ID WP_000170926.1
Coordinates 3187547..3187654 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 3187707..3187768 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG29_RS16795 3182856..3183938 + 1083 WP_000804726.1 peptide chain release factor 1 -
RG29_RS16800 3183938..3184771 + 834 WP_000456459.1 peptide chain release factor N(5)-glutamine methyltransferase -
RG29_RS16805 3184768..3185160 + 393 WP_000200392.1 invasion regulator SirB2 -
RG29_RS16810 3185164..3185973 + 810 WP_001257044.1 invasion regulator SirB1 -
RG29_RS16815 3186009..3186863 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
RG29_RS16820 3187012..3187119 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3187167..3187233 + 67 NuclAT_44 - -
- 3187167..3187233 + 67 NuclAT_44 - -
- 3187167..3187233 + 67 NuclAT_44 - -
- 3187167..3187233 + 67 NuclAT_44 - -
- 3187167..3187233 + 67 NuclAT_47 - -
- 3187167..3187233 + 67 NuclAT_47 - -
- 3187167..3187233 + 67 NuclAT_47 - -
- 3187167..3187233 + 67 NuclAT_47 - -
- 3187169..3187232 + 64 NuclAT_16 - -
- 3187169..3187232 + 64 NuclAT_16 - -
- 3187169..3187232 + 64 NuclAT_16 - -
- 3187169..3187232 + 64 NuclAT_16 - -
- 3187169..3187232 + 64 NuclAT_19 - -
- 3187169..3187232 + 64 NuclAT_19 - -
- 3187169..3187232 + 64 NuclAT_19 - -
- 3187169..3187232 + 64 NuclAT_19 - -
- 3187169..3187232 + 64 NuclAT_22 - -
- 3187169..3187232 + 64 NuclAT_22 - -
- 3187169..3187232 + 64 NuclAT_22 - -
- 3187169..3187232 + 64 NuclAT_22 - -
- 3187169..3187232 + 64 NuclAT_25 - -
- 3187169..3187232 + 64 NuclAT_25 - -
- 3187169..3187232 + 64 NuclAT_25 - -
- 3187169..3187232 + 64 NuclAT_25 - -
- 3187169..3187232 + 64 NuclAT_28 - -
- 3187169..3187232 + 64 NuclAT_28 - -
- 3187169..3187232 + 64 NuclAT_28 - -
- 3187169..3187232 + 64 NuclAT_28 - -
- 3187169..3187232 + 64 NuclAT_31 - -
- 3187169..3187232 + 64 NuclAT_31 - -
- 3187169..3187232 + 64 NuclAT_31 - -
- 3187169..3187232 + 64 NuclAT_31 - -
RG29_RS29985 3187547..3187654 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3187707..3187768 + 62 NuclAT_15 - Antitoxin
- 3187707..3187768 + 62 NuclAT_15 - Antitoxin
- 3187707..3187768 + 62 NuclAT_15 - Antitoxin
- 3187707..3187768 + 62 NuclAT_15 - Antitoxin
- 3187707..3187768 + 62 NuclAT_18 - Antitoxin
- 3187707..3187768 + 62 NuclAT_18 - Antitoxin
- 3187707..3187768 + 62 NuclAT_18 - Antitoxin
- 3187707..3187768 + 62 NuclAT_18 - Antitoxin
- 3187707..3187768 + 62 NuclAT_21 - Antitoxin
- 3187707..3187768 + 62 NuclAT_21 - Antitoxin
- 3187707..3187768 + 62 NuclAT_21 - Antitoxin
- 3187707..3187768 + 62 NuclAT_21 - Antitoxin
- 3187707..3187768 + 62 NuclAT_24 - Antitoxin
- 3187707..3187768 + 62 NuclAT_24 - Antitoxin
- 3187707..3187768 + 62 NuclAT_24 - Antitoxin
- 3187707..3187768 + 62 NuclAT_24 - Antitoxin
- 3187707..3187768 + 62 NuclAT_27 - Antitoxin
- 3187707..3187768 + 62 NuclAT_27 - Antitoxin
- 3187707..3187768 + 62 NuclAT_27 - Antitoxin
- 3187707..3187768 + 62 NuclAT_27 - Antitoxin
- 3187707..3187768 + 62 NuclAT_30 - Antitoxin
- 3187707..3187768 + 62 NuclAT_30 - Antitoxin
- 3187707..3187768 + 62 NuclAT_30 - Antitoxin
- 3187707..3187768 + 62 NuclAT_30 - Antitoxin
- 3187707..3187769 + 63 NuclAT_45 - -
- 3187707..3187769 + 63 NuclAT_45 - -
- 3187707..3187769 + 63 NuclAT_45 - -
- 3187707..3187769 + 63 NuclAT_45 - -
- 3187707..3187769 + 63 NuclAT_48 - -
- 3187707..3187769 + 63 NuclAT_48 - -
- 3187707..3187769 + 63 NuclAT_48 - -
- 3187707..3187769 + 63 NuclAT_48 - -
- 3187707..3187770 + 64 NuclAT_33 - -
- 3187707..3187770 + 64 NuclAT_33 - -
- 3187707..3187770 + 64 NuclAT_33 - -
- 3187707..3187770 + 64 NuclAT_33 - -
- 3187707..3187770 + 64 NuclAT_35 - -
- 3187707..3187770 + 64 NuclAT_35 - -
- 3187707..3187770 + 64 NuclAT_35 - -
- 3187707..3187770 + 64 NuclAT_35 - -
- 3187707..3187770 + 64 NuclAT_37 - -
- 3187707..3187770 + 64 NuclAT_37 - -
- 3187707..3187770 + 64 NuclAT_37 - -
- 3187707..3187770 + 64 NuclAT_37 - -
- 3187707..3187770 + 64 NuclAT_39 - -
- 3187707..3187770 + 64 NuclAT_39 - -
- 3187707..3187770 + 64 NuclAT_39 - -
- 3187707..3187770 + 64 NuclAT_39 - -
- 3187707..3187770 + 64 NuclAT_41 - -
- 3187707..3187770 + 64 NuclAT_41 - -
- 3187707..3187770 + 64 NuclAT_41 - -
- 3187707..3187770 + 64 NuclAT_41 - -
- 3187707..3187770 + 64 NuclAT_43 - -
- 3187707..3187770 + 64 NuclAT_43 - -
- 3187707..3187770 + 64 NuclAT_43 - -
- 3187707..3187770 + 64 NuclAT_43 - -
RG29_RS16840 3188083..3188190 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3188238..3188303 + 66 NuclAT_14 - -
- 3188238..3188303 + 66 NuclAT_14 - -
- 3188238..3188303 + 66 NuclAT_14 - -
- 3188238..3188303 + 66 NuclAT_14 - -
- 3188238..3188303 + 66 NuclAT_17 - -
- 3188238..3188303 + 66 NuclAT_17 - -
- 3188238..3188303 + 66 NuclAT_17 - -
- 3188238..3188303 + 66 NuclAT_17 - -
- 3188238..3188303 + 66 NuclAT_20 - -
- 3188238..3188303 + 66 NuclAT_20 - -
- 3188238..3188303 + 66 NuclAT_20 - -
- 3188238..3188303 + 66 NuclAT_20 - -
- 3188238..3188303 + 66 NuclAT_23 - -
- 3188238..3188303 + 66 NuclAT_23 - -
- 3188238..3188303 + 66 NuclAT_23 - -
- 3188238..3188303 + 66 NuclAT_23 - -
- 3188238..3188303 + 66 NuclAT_26 - -
- 3188238..3188303 + 66 NuclAT_26 - -
- 3188238..3188303 + 66 NuclAT_26 - -
- 3188238..3188303 + 66 NuclAT_26 - -
- 3188238..3188303 + 66 NuclAT_29 - -
- 3188238..3188303 + 66 NuclAT_29 - -
- 3188238..3188303 + 66 NuclAT_29 - -
- 3188238..3188303 + 66 NuclAT_29 - -
- 3188238..3188305 + 68 NuclAT_32 - -
- 3188238..3188305 + 68 NuclAT_32 - -
- 3188238..3188305 + 68 NuclAT_32 - -
- 3188238..3188305 + 68 NuclAT_32 - -
- 3188238..3188305 + 68 NuclAT_34 - -
- 3188238..3188305 + 68 NuclAT_34 - -
- 3188238..3188305 + 68 NuclAT_34 - -
- 3188238..3188305 + 68 NuclAT_34 - -
- 3188238..3188305 + 68 NuclAT_36 - -
- 3188238..3188305 + 68 NuclAT_36 - -
- 3188238..3188305 + 68 NuclAT_36 - -
- 3188238..3188305 + 68 NuclAT_36 - -
- 3188238..3188305 + 68 NuclAT_38 - -
- 3188238..3188305 + 68 NuclAT_38 - -
- 3188238..3188305 + 68 NuclAT_38 - -
- 3188238..3188305 + 68 NuclAT_38 - -
- 3188238..3188305 + 68 NuclAT_40 - -
- 3188238..3188305 + 68 NuclAT_40 - -
- 3188238..3188305 + 68 NuclAT_40 - -
- 3188238..3188305 + 68 NuclAT_40 - -
- 3188238..3188305 + 68 NuclAT_42 - -
- 3188238..3188305 + 68 NuclAT_42 - -
- 3188238..3188305 + 68 NuclAT_42 - -
- 3188238..3188305 + 68 NuclAT_42 - -
- 3188239..3188304 + 66 NuclAT_46 - -
- 3188239..3188304 + 66 NuclAT_46 - -
- 3188239..3188304 + 66 NuclAT_46 - -
- 3188239..3188304 + 66 NuclAT_46 - -
- 3188239..3188304 + 66 NuclAT_49 - -
- 3188239..3188304 + 66 NuclAT_49 - -
- 3188239..3188304 + 66 NuclAT_49 - -
- 3188239..3188304 + 66 NuclAT_49 - -
RG29_RS16850 3188595..3189695 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
RG29_RS16855 3189965..3190195 + 231 WP_001146442.1 putative cation transport regulator ChaB -
RG29_RS16860 3190353..3191048 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
RG29_RS16865 3191092..3191445 - 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.84 Da        Isoelectric Point: 11.6501

>T51728 WP_000170926.1 NZ_CP010240:c3187654-3187547 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T51728 NZ_CP010240:c3187654-3187547 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT51728 NZ_CP010240:3187707-3187768 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y1K9

Antitoxin

Download structure file

References