Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 30597..30867 | Replicon | plasmid B |
| Accession | NZ_CP010223 | ||
| Organism | Escherichia coli strain M19 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | RG63_RS27640 | Protein ID | WP_001312861.1 |
| Coordinates | 30709..30867 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 30597..30660 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG63_RS27595 | 25673..25900 | + | 228 | WP_071594011.1 | hypothetical protein | - |
| RG63_RS27605 | 26141..26347 | + | 207 | WP_073520019.1 | single-stranded DNA-binding protein | - |
| RG63_RS27610 | 26373..26912 | + | 540 | WP_009426937.1 | single-stranded DNA-binding protein | - |
| RG63_RS27615 | 26968..27201 | + | 234 | WP_001519997.1 | DUF905 family protein | - |
| RG63_RS27620 | 27266..29224 | + | 1959 | WP_073520020.1 | ParB/RepB/Spo0J family partition protein | - |
| RG63_RS27625 | 29279..29713 | + | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
| RG63_RS27630 | 29710..30429 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
| RG63_RS29615 | 30441..30629 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 30441..30665 | + | 225 | NuclAT_0 | - | - |
| - | 30441..30665 | + | 225 | NuclAT_0 | - | - |
| - | 30441..30665 | + | 225 | NuclAT_0 | - | - |
| - | 30441..30665 | + | 225 | NuclAT_0 | - | - |
| - | 30597..30660 | - | 64 | - | - | Antitoxin |
| RG63_RS27640 | 30709..30867 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| RG63_RS27655 | 31557..31763 | + | 207 | WP_073520019.1 | single-stranded DNA-binding protein | - |
| RG63_RS27660 | 31788..32075 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| RG63_RS27665 | 32193..33014 | + | 822 | WP_073520018.1 | DUF945 domain-containing protein | - |
| RG63_RS27670 | 33311..33958 | - | 648 | WP_000614935.1 | transglycosylase SLT domain-containing protein | - |
| RG63_RS27680 | 34235..34618 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
| RG63_RS27685 | 34809..35495 | + | 687 | WP_073520017.1 | PAS domain-containing protein | - |
| RG63_RS27690 | 35589..35816 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..61063 | 61063 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T51491 WP_001312861.1 NZ_CP010223:30709-30867 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T51491 NZ_CP010223:30709-30867 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT51491 NZ_CP010223:c30660-30597 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|