Detailed information of TA system TA051415

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 61967..62221
• Replicon: plasmid A
• Accession: NZ_CP010214
• Organism: Escherichia coli strain M15

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: RG61_RS26965
• Protein ID: WP_001312851.1
• Coordinates: 61967..62116 (-)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	62165..62221 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
RG61_RS29225	57486..57569	-	84	Protein_67	maturase	-
RG61_RS26905	57727..58266	+	540	WP_077897976.1	recombinase family protein	-
RG61_RS26910	58259..58531	+	273	WP_046201741.1	hypothetical protein	-
RG61_RS26915	58535..58834	-	300	WP_073519916.1	hypothetical protein	-
RG61_RS26920	58986..59201	-	216	WP_073519917.1	type II toxin-antitoxin system RelE/ParE family toxin	-
RG61_RS26925	59198..59467	-	270	WP_073519918.1	hypothetical protein	-
RG61_RS26935	59679..59810	+	132	WP_071595370.1	replication protein RepA4	-
RG61_RS26940	59826..60020	-	195	WP_073519921.1	replication protein	-
RG61_RS26945	60382..61210	-	829	Protein_75	incFII family plasmid replication initiator RepA	-
RG61_RS26950	61203..61277	-	75	WP_001365705.1	RepA leader peptide Tap	-
RG61_RS26955	61344..61492	+	149	Protein_77	replication protein RepA	-
RG61_RS26960	61509..61766	-	258	WP_073519922.1	replication regulatory protein RepA	-
RG61_RS26965	61967..62116	-	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	62165..62221	+	57	NuclAT_1	-	Antitoxin
-	62165..62221	+	57	NuclAT_1	-	Antitoxin
-	62165..62221	+	57	NuclAT_1	-	Antitoxin
-	62165..62221	+	57	NuclAT_1	-	Antitoxin
RG61_RS26970	62172..62414	+	243	WP_071996372.1	hypothetical protein	-
RG61_RS26975	62394..62984	-	591	WP_032334802.1	DUF2726 domain-containing protein	-
RG61_RS26980	63022..63231	-	210	WP_001299729.1	hemolysin expression modulator Hha	-
RG61_RS26985	63277..63738	-	462	WP_077898159.1	thermonuclease family protein	-
RG61_RS26990	63981..64193	-	213	WP_032334799.1	hypothetical protein	-
RG61_RS26995	64327..64887	-	561	Protein_85	fertility inhibition protein FinO	-
RG61_RS27000	64942..65676	-	735	WP_073519924.1	type-F conjugative transfer system pilin acetylase TraX	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	faeI / faeH / faeF / faeE / faeD / faeC / pic	1..146496	146496

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T51415 WP_001312851.1 NZ_CP010214:c62116-61967 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T51415 NZ_CP010214:c62116-61967 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 57 bp

>AT51415 NZ_CP010214:62165-62221 [Escherichia coli]
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin