Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 61967..62221 | Replicon | plasmid A |
| Accession | NZ_CP010214 | ||
| Organism | Escherichia coli strain M15 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | RG61_RS26965 | Protein ID | WP_001312851.1 |
| Coordinates | 61967..62116 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 62165..62221 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG61_RS29225 | 57486..57569 | - | 84 | Protein_67 | maturase | - |
| RG61_RS26905 | 57727..58266 | + | 540 | WP_077897976.1 | recombinase family protein | - |
| RG61_RS26910 | 58259..58531 | + | 273 | WP_046201741.1 | hypothetical protein | - |
| RG61_RS26915 | 58535..58834 | - | 300 | WP_073519916.1 | hypothetical protein | - |
| RG61_RS26920 | 58986..59201 | - | 216 | WP_073519917.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| RG61_RS26925 | 59198..59467 | - | 270 | WP_073519918.1 | hypothetical protein | - |
| RG61_RS26935 | 59679..59810 | + | 132 | WP_071595370.1 | replication protein RepA4 | - |
| RG61_RS26940 | 59826..60020 | - | 195 | WP_073519921.1 | replication protein | - |
| RG61_RS26945 | 60382..61210 | - | 829 | Protein_75 | incFII family plasmid replication initiator RepA | - |
| RG61_RS26950 | 61203..61277 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| RG61_RS26955 | 61344..61492 | + | 149 | Protein_77 | replication protein RepA | - |
| RG61_RS26960 | 61509..61766 | - | 258 | WP_073519922.1 | replication regulatory protein RepA | - |
| RG61_RS26965 | 61967..62116 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 62165..62221 | + | 57 | NuclAT_1 | - | Antitoxin |
| - | 62165..62221 | + | 57 | NuclAT_1 | - | Antitoxin |
| - | 62165..62221 | + | 57 | NuclAT_1 | - | Antitoxin |
| - | 62165..62221 | + | 57 | NuclAT_1 | - | Antitoxin |
| RG61_RS26970 | 62172..62414 | + | 243 | WP_071996372.1 | hypothetical protein | - |
| RG61_RS26975 | 62394..62984 | - | 591 | WP_032334802.1 | DUF2726 domain-containing protein | - |
| RG61_RS26980 | 63022..63231 | - | 210 | WP_001299729.1 | hemolysin expression modulator Hha | - |
| RG61_RS26985 | 63277..63738 | - | 462 | WP_077898159.1 | thermonuclease family protein | - |
| RG61_RS26990 | 63981..64193 | - | 213 | WP_032334799.1 | hypothetical protein | - |
| RG61_RS26995 | 64327..64887 | - | 561 | Protein_85 | fertility inhibition protein FinO | - |
| RG61_RS27000 | 64942..65676 | - | 735 | WP_073519924.1 | type-F conjugative transfer system pilin acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | faeI / faeH / faeF / faeE / faeD / faeC / pic | 1..146496 | 146496 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T51415 WP_001312851.1 NZ_CP010214:c62116-61967 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T51415 NZ_CP010214:c62116-61967 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT51415 NZ_CP010214:62165-62221 [Escherichia coli]
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|