51181

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 37850..38070 Replicon chromosome
Accession NZ_CP010180
Organism Escherichia coli strain M1

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag RG54_RS00185 Protein ID WP_000170954.1
Coordinates 37850..37957 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 38007..38070 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG54_RS00160 33694..34776 + 1083 WP_000804726.1 peptide chain release factor 1 -
RG54_RS00165 34776..35609 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
RG54_RS00170 35606..35998 + 393 WP_032283162.1 invasion regulator SirB2 -
RG54_RS00175 36002..36811 + 810 WP_001257044.1 invasion regulator SirB1 -
RG54_RS00180 36847..37701 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
RG54_RS00185 37850..37957 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 38007..38070 + 64 NuclAT_46 - Antitoxin
- 38007..38070 + 64 NuclAT_46 - Antitoxin
- 38007..38070 + 64 NuclAT_46 - Antitoxin
- 38007..38070 + 64 NuclAT_46 - Antitoxin
- 38007..38070 + 64 NuclAT_49 - Antitoxin
- 38007..38070 + 64 NuclAT_49 - Antitoxin
- 38007..38070 + 64 NuclAT_49 - Antitoxin
- 38007..38070 + 64 NuclAT_49 - Antitoxin
RG54_RS27675 38385..38492 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 38545..38606 + 62 NuclAT_45 - -
- 38545..38606 + 62 NuclAT_45 - -
- 38545..38606 + 62 NuclAT_45 - -
- 38545..38606 + 62 NuclAT_45 - -
- 38545..38606 + 62 NuclAT_48 - -
- 38545..38606 + 62 NuclAT_48 - -
- 38545..38606 + 62 NuclAT_48 - -
- 38545..38606 + 62 NuclAT_48 - -
- 38545..38608 + 64 NuclAT_15 - -
- 38545..38608 + 64 NuclAT_15 - -
- 38545..38608 + 64 NuclAT_15 - -
- 38545..38608 + 64 NuclAT_15 - -
- 38545..38608 + 64 NuclAT_17 - -
- 38545..38608 + 64 NuclAT_17 - -
- 38545..38608 + 64 NuclAT_17 - -
- 38545..38608 + 64 NuclAT_17 - -
- 38545..38608 + 64 NuclAT_19 - -
- 38545..38608 + 64 NuclAT_19 - -
- 38545..38608 + 64 NuclAT_19 - -
- 38545..38608 + 64 NuclAT_19 - -
- 38545..38608 + 64 NuclAT_21 - -
- 38545..38608 + 64 NuclAT_21 - -
- 38545..38608 + 64 NuclAT_21 - -
- 38545..38608 + 64 NuclAT_21 - -
- 38545..38608 + 64 NuclAT_23 - -
- 38545..38608 + 64 NuclAT_23 - -
- 38545..38608 + 64 NuclAT_23 - -
- 38545..38608 + 64 NuclAT_23 - -
- 38545..38608 + 64 NuclAT_25 - -
- 38545..38608 + 64 NuclAT_25 - -
- 38545..38608 + 64 NuclAT_25 - -
- 38545..38608 + 64 NuclAT_25 - -
RG54_RS00205 38921..39028 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 39076..39141 + 66 NuclAT_44 - -
- 39076..39141 + 66 NuclAT_44 - -
- 39076..39141 + 66 NuclAT_44 - -
- 39076..39141 + 66 NuclAT_44 - -
- 39076..39141 + 66 NuclAT_47 - -
- 39076..39141 + 66 NuclAT_47 - -
- 39076..39141 + 66 NuclAT_47 - -
- 39076..39141 + 66 NuclAT_47 - -
- 39076..39143 + 68 NuclAT_14 - -
- 39076..39143 + 68 NuclAT_14 - -
- 39076..39143 + 68 NuclAT_14 - -
- 39076..39143 + 68 NuclAT_14 - -
- 39076..39143 + 68 NuclAT_16 - -
- 39076..39143 + 68 NuclAT_16 - -
- 39076..39143 + 68 NuclAT_16 - -
- 39076..39143 + 68 NuclAT_16 - -
- 39076..39143 + 68 NuclAT_18 - -
- 39076..39143 + 68 NuclAT_18 - -
- 39076..39143 + 68 NuclAT_18 - -
- 39076..39143 + 68 NuclAT_18 - -
- 39076..39143 + 68 NuclAT_20 - -
- 39076..39143 + 68 NuclAT_20 - -
- 39076..39143 + 68 NuclAT_20 - -
- 39076..39143 + 68 NuclAT_20 - -
- 39076..39143 + 68 NuclAT_22 - -
- 39076..39143 + 68 NuclAT_22 - -
- 39076..39143 + 68 NuclAT_22 - -
- 39076..39143 + 68 NuclAT_22 - -
- 39076..39143 + 68 NuclAT_24 - -
- 39076..39143 + 68 NuclAT_24 - -
- 39076..39143 + 68 NuclAT_24 - -
- 39076..39143 + 68 NuclAT_24 - -
RG54_RS00215 39433..40533 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
RG54_RS00220 40803..41033 + 231 WP_001146442.1 putative cation transport regulator ChaB -
RG54_RS00225 41191..41886 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
RG54_RS00230 41930..42283 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T51181 WP_000170954.1 NZ_CP010180:c37957-37850 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T51181 NZ_CP010180:c37957-37850 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT51181 NZ_CP010180:38007-38070 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTAAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References