Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1020411..1020631 Replicon chromosome
Accession NZ_CP010178
Organism Escherichia coli strain H15

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag RG53_RS05300 Protein ID WP_000170965.1
Coordinates 1020411..1020518 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1020565..1020631 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG53_RS05260 1016266..1017099 + 834 WP_000456471.1 peptide chain release factor N(5)-glutamine methyltransferase -
RG53_RS05265 1017096..1017488 + 393 WP_000200392.1 invasion regulator SirB2 -
RG53_RS05270 1017492..1018301 + 810 WP_001257044.1 invasion regulator SirB1 -
RG53_RS05275 1018337..1019191 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
RG53_RS05280 1019340..1019447 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1019495..1019561 + 67 NuclAT_44 - -
- 1019495..1019561 + 67 NuclAT_44 - -
- 1019495..1019561 + 67 NuclAT_44 - -
- 1019495..1019561 + 67 NuclAT_44 - -
- 1019495..1019561 + 67 NuclAT_47 - -
- 1019495..1019561 + 67 NuclAT_47 - -
- 1019495..1019561 + 67 NuclAT_47 - -
- 1019495..1019561 + 67 NuclAT_47 - -
- 1019495..1019561 + 67 NuclAT_50 - -
- 1019495..1019561 + 67 NuclAT_50 - -
- 1019495..1019561 + 67 NuclAT_50 - -
- 1019495..1019561 + 67 NuclAT_50 - -
- 1019497..1019560 + 64 NuclAT_16 - -
- 1019497..1019560 + 64 NuclAT_16 - -
- 1019497..1019560 + 64 NuclAT_16 - -
- 1019497..1019560 + 64 NuclAT_16 - -
- 1019497..1019560 + 64 NuclAT_19 - -
- 1019497..1019560 + 64 NuclAT_19 - -
- 1019497..1019560 + 64 NuclAT_19 - -
- 1019497..1019560 + 64 NuclAT_19 - -
- 1019497..1019560 + 64 NuclAT_22 - -
- 1019497..1019560 + 64 NuclAT_22 - -
- 1019497..1019560 + 64 NuclAT_22 - -
- 1019497..1019560 + 64 NuclAT_22 - -
- 1019497..1019560 + 64 NuclAT_25 - -
- 1019497..1019560 + 64 NuclAT_25 - -
- 1019497..1019560 + 64 NuclAT_25 - -
- 1019497..1019560 + 64 NuclAT_25 - -
- 1019497..1019560 + 64 NuclAT_28 - -
- 1019497..1019560 + 64 NuclAT_28 - -
- 1019497..1019560 + 64 NuclAT_28 - -
- 1019497..1019560 + 64 NuclAT_28 - -
- 1019497..1019560 + 64 NuclAT_31 - -
- 1019497..1019560 + 64 NuclAT_31 - -
- 1019497..1019560 + 64 NuclAT_31 - -
- 1019497..1019560 + 64 NuclAT_31 - -
RG53_RS25710 1019875..1019982 - 108 WP_024208805.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1020035..1020096 + 62 NuclAT_15 - -
- 1020035..1020096 + 62 NuclAT_15 - -
- 1020035..1020096 + 62 NuclAT_15 - -
- 1020035..1020096 + 62 NuclAT_15 - -
- 1020035..1020096 + 62 NuclAT_18 - -
- 1020035..1020096 + 62 NuclAT_18 - -
- 1020035..1020096 + 62 NuclAT_18 - -
- 1020035..1020096 + 62 NuclAT_18 - -
- 1020035..1020096 + 62 NuclAT_21 - -
- 1020035..1020096 + 62 NuclAT_21 - -
- 1020035..1020096 + 62 NuclAT_21 - -
- 1020035..1020096 + 62 NuclAT_21 - -
- 1020035..1020096 + 62 NuclAT_24 - -
- 1020035..1020096 + 62 NuclAT_24 - -
- 1020035..1020096 + 62 NuclAT_24 - -
- 1020035..1020096 + 62 NuclAT_24 - -
- 1020035..1020096 + 62 NuclAT_27 - -
- 1020035..1020096 + 62 NuclAT_27 - -
- 1020035..1020096 + 62 NuclAT_27 - -
- 1020035..1020096 + 62 NuclAT_27 - -
- 1020035..1020096 + 62 NuclAT_30 - -
- 1020035..1020096 + 62 NuclAT_30 - -
- 1020035..1020096 + 62 NuclAT_30 - -
- 1020035..1020096 + 62 NuclAT_30 - -
- 1020035..1020097 + 63 NuclAT_45 - -
- 1020035..1020097 + 63 NuclAT_45 - -
- 1020035..1020097 + 63 NuclAT_45 - -
- 1020035..1020097 + 63 NuclAT_45 - -
- 1020035..1020097 + 63 NuclAT_48 - -
- 1020035..1020097 + 63 NuclAT_48 - -
- 1020035..1020097 + 63 NuclAT_48 - -
- 1020035..1020097 + 63 NuclAT_48 - -
- 1020035..1020097 + 63 NuclAT_51 - -
- 1020035..1020097 + 63 NuclAT_51 - -
- 1020035..1020097 + 63 NuclAT_51 - -
- 1020035..1020097 + 63 NuclAT_51 - -
- 1020035..1020098 + 64 NuclAT_33 - -
- 1020035..1020098 + 64 NuclAT_33 - -
- 1020035..1020098 + 64 NuclAT_33 - -
- 1020035..1020098 + 64 NuclAT_33 - -
- 1020035..1020098 + 64 NuclAT_35 - -
- 1020035..1020098 + 64 NuclAT_35 - -
- 1020035..1020098 + 64 NuclAT_35 - -
- 1020035..1020098 + 64 NuclAT_35 - -
- 1020035..1020098 + 64 NuclAT_37 - -
- 1020035..1020098 + 64 NuclAT_37 - -
- 1020035..1020098 + 64 NuclAT_37 - -
- 1020035..1020098 + 64 NuclAT_37 - -
- 1020035..1020098 + 64 NuclAT_39 - -
- 1020035..1020098 + 64 NuclAT_39 - -
- 1020035..1020098 + 64 NuclAT_39 - -
- 1020035..1020098 + 64 NuclAT_39 - -
- 1020035..1020098 + 64 NuclAT_41 - -
- 1020035..1020098 + 64 NuclAT_41 - -
- 1020035..1020098 + 64 NuclAT_41 - -
- 1020035..1020098 + 64 NuclAT_41 - -
- 1020035..1020098 + 64 NuclAT_43 - -
- 1020035..1020098 + 64 NuclAT_43 - -
- 1020035..1020098 + 64 NuclAT_43 - -
- 1020035..1020098 + 64 NuclAT_43 - -
RG53_RS05300 1020411..1020518 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1020565..1020631 + 67 - - Antitoxin
RG53_RS05310 1020923..1022023 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
RG53_RS05315 1022293..1022523 + 231 WP_001146442.1 putative cation transport regulator ChaB -
RG53_RS05320 1022681..1023376 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
RG53_RS05325 1023420..1023773 - 354 WP_001169671.1 DsrE/F sulfur relay family protein YchN -
RG53_RS05330 1023958..1025352 + 1395 WP_000086213.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T51159 WP_000170965.1 NZ_CP010178:c1020518-1020411 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T51159 NZ_CP010178:c1020518-1020411 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT51159 NZ_CP010178:1020565-1020631 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References