Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 1019875..1020096 | Replicon | chromosome |
| Accession | NZ_CP010178 | ||
| Organism | Escherichia coli strain H15 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A377MZG8 |
| Locus tag | RG53_RS25710 | Protein ID | WP_024208805.1 |
| Coordinates | 1019875..1019982 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 1020035..1020096 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG53_RS05255 | 1015184..1016266 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| RG53_RS05260 | 1016266..1017099 | + | 834 | WP_000456471.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| RG53_RS05265 | 1017096..1017488 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| RG53_RS05270 | 1017492..1018301 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| RG53_RS05275 | 1018337..1019191 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| RG53_RS05280 | 1019340..1019447 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1019495..1019561 | + | 67 | NuclAT_44 | - | - |
| - | 1019495..1019561 | + | 67 | NuclAT_44 | - | - |
| - | 1019495..1019561 | + | 67 | NuclAT_44 | - | - |
| - | 1019495..1019561 | + | 67 | NuclAT_44 | - | - |
| - | 1019495..1019561 | + | 67 | NuclAT_47 | - | - |
| - | 1019495..1019561 | + | 67 | NuclAT_47 | - | - |
| - | 1019495..1019561 | + | 67 | NuclAT_47 | - | - |
| - | 1019495..1019561 | + | 67 | NuclAT_47 | - | - |
| - | 1019495..1019561 | + | 67 | NuclAT_50 | - | - |
| - | 1019495..1019561 | + | 67 | NuclAT_50 | - | - |
| - | 1019495..1019561 | + | 67 | NuclAT_50 | - | - |
| - | 1019495..1019561 | + | 67 | NuclAT_50 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_16 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_16 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_16 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_16 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_19 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_19 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_19 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_19 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_22 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_22 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_22 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_22 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_25 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_25 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_25 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_25 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_28 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_28 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_28 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_28 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_31 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_31 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_31 | - | - |
| - | 1019497..1019560 | + | 64 | NuclAT_31 | - | - |
| RG53_RS25710 | 1019875..1019982 | - | 108 | WP_024208805.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1020035..1020096 | + | 62 | NuclAT_15 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_15 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_15 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_15 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_18 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_18 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_18 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_18 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_21 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_21 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_21 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_21 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_24 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_24 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_24 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_24 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_27 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_27 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_27 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_27 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_30 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_30 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_30 | - | Antitoxin |
| - | 1020035..1020096 | + | 62 | NuclAT_30 | - | Antitoxin |
| - | 1020035..1020097 | + | 63 | NuclAT_45 | - | - |
| - | 1020035..1020097 | + | 63 | NuclAT_45 | - | - |
| - | 1020035..1020097 | + | 63 | NuclAT_45 | - | - |
| - | 1020035..1020097 | + | 63 | NuclAT_45 | - | - |
| - | 1020035..1020097 | + | 63 | NuclAT_48 | - | - |
| - | 1020035..1020097 | + | 63 | NuclAT_48 | - | - |
| - | 1020035..1020097 | + | 63 | NuclAT_48 | - | - |
| - | 1020035..1020097 | + | 63 | NuclAT_48 | - | - |
| - | 1020035..1020097 | + | 63 | NuclAT_51 | - | - |
| - | 1020035..1020097 | + | 63 | NuclAT_51 | - | - |
| - | 1020035..1020097 | + | 63 | NuclAT_51 | - | - |
| - | 1020035..1020097 | + | 63 | NuclAT_51 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_33 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_33 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_33 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_33 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_35 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_35 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_35 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_35 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_37 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_37 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_37 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_37 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_39 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_39 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_39 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_39 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_41 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_41 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_41 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_41 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_43 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_43 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_43 | - | - |
| - | 1020035..1020098 | + | 64 | NuclAT_43 | - | - |
| RG53_RS05300 | 1020411..1020518 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1020566..1020631 | + | 66 | NuclAT_14 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_14 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_14 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_14 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_17 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_17 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_17 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_17 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_20 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_20 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_20 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_20 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_23 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_23 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_23 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_23 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_26 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_26 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_26 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_26 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_29 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_29 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_29 | - | - |
| - | 1020566..1020631 | + | 66 | NuclAT_29 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_32 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_32 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_32 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_32 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_34 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_34 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_34 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_34 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_36 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_36 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_36 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_36 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_38 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_38 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_38 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_38 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_40 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_40 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_40 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_40 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_42 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_42 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_42 | - | - |
| - | 1020566..1020633 | + | 68 | NuclAT_42 | - | - |
| - | 1020567..1020632 | + | 66 | NuclAT_46 | - | - |
| - | 1020567..1020632 | + | 66 | NuclAT_46 | - | - |
| - | 1020567..1020632 | + | 66 | NuclAT_46 | - | - |
| - | 1020567..1020632 | + | 66 | NuclAT_46 | - | - |
| - | 1020567..1020632 | + | 66 | NuclAT_49 | - | - |
| - | 1020567..1020632 | + | 66 | NuclAT_49 | - | - |
| - | 1020567..1020632 | + | 66 | NuclAT_49 | - | - |
| - | 1020567..1020632 | + | 66 | NuclAT_49 | - | - |
| - | 1020567..1020632 | + | 66 | NuclAT_52 | - | - |
| - | 1020567..1020632 | + | 66 | NuclAT_52 | - | - |
| - | 1020567..1020632 | + | 66 | NuclAT_52 | - | - |
| - | 1020567..1020632 | + | 66 | NuclAT_52 | - | - |
| RG53_RS05310 | 1020923..1022023 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| RG53_RS05315 | 1022293..1022523 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| RG53_RS05320 | 1022681..1023376 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| RG53_RS05325 | 1023420..1023773 | - | 354 | WP_001169671.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.87 Da Isoelectric Point: 11.6501
>T51155 WP_024208805.1 NZ_CP010178:c1019982-1019875 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAKFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T51155 NZ_CP010178:c1019982-1019875 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT51155 NZ_CP010178:1020035-1020096 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
