Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 60148..60417 | Replicon | plasmid B |
Accession | NZ_CP010174 | ||
Organism | Escherichia coli strain H8 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | RG50_RS26930 | Protein ID | WP_001312861.1 |
Coordinates | 60259..60417 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 60148..60213 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG50_RS26900 | 55858..56385 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
RG50_RS26905 | 56443..56676 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
RG50_RS26910 | 56737..58760 | + | 2024 | Protein_70 | ParB/RepB/Spo0J family partition protein | - |
RG50_RS26915 | 58829..59263 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
RG50_RS26920 | 59260..59979 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 59991..60215 | + | 225 | NuclAT_0 | - | - |
- | 59991..60215 | + | 225 | NuclAT_0 | - | - |
- | 59991..60215 | + | 225 | NuclAT_0 | - | - |
- | 59991..60215 | + | 225 | NuclAT_0 | - | - |
RG50_RS28930 | 60000..60179 | - | 180 | WP_001309233.1 | hypothetical protein | - |
- | 60148..60213 | + | 66 | - | - | Antitoxin |
RG50_RS26930 | 60259..60417 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
RG50_RS29125 | 60655..61032 | - | 378 | Protein_75 | hypothetical protein | - |
RG50_RS26950 | 61332..61628 | + | 297 | WP_001272251.1 | hypothetical protein | - |
RG50_RS26955 | 61739..62560 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
RG50_RS26960 | 62857..63459 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
RG50_RS26965 | 63782..64165 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
RG50_RS26970 | 64359..65030 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
RG50_RS26975 | 65167..65394 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aadA5 / dfrA17 / aac(3)-IIa / erm(B) / blaTEM-1B / blaCTX-M-15 | - | 1..106274 | 106274 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T51104 WP_001312861.1 NZ_CP010174:60259-60417 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T51104 NZ_CP010174:60259-60417 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT51104 NZ_CP010174:60148-60213 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|