Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2470488..2470709 | Replicon | chromosome |
| Accession | NZ_CP010167 | ||
| Organism | Escherichia coli strain H3 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | RG46_RS12715 | Protein ID | WP_000170954.1 |
| Coordinates | 2470488..2470595 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2470643..2470709 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG46_RS12690 | 2466332..2467414 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| RG46_RS12695 | 2467414..2468247 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| RG46_RS12700 | 2468244..2468636 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| RG46_RS12705 | 2468640..2469449 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| RG46_RS12710 | 2469485..2470339 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| RG46_RS12715 | 2470488..2470595 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2470643..2470709 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_28 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_28 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_28 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_28 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_30 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_30 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_30 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_30 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_32 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_32 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_32 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_32 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_34 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_34 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_34 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_34 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_36 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_36 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_36 | - | Antitoxin |
| - | 2470643..2470709 | + | 67 | NuclAT_36 | - | Antitoxin |
| - | 2470645..2470708 | + | 64 | NuclAT_39 | - | - |
| - | 2470645..2470708 | + | 64 | NuclAT_39 | - | - |
| - | 2470645..2470708 | + | 64 | NuclAT_39 | - | - |
| - | 2470645..2470708 | + | 64 | NuclAT_39 | - | - |
| - | 2470645..2470708 | + | 64 | NuclAT_41 | - | - |
| - | 2470645..2470708 | + | 64 | NuclAT_41 | - | - |
| - | 2470645..2470708 | + | 64 | NuclAT_41 | - | - |
| - | 2470645..2470708 | + | 64 | NuclAT_41 | - | - |
| - | 2470645..2470708 | + | 64 | NuclAT_43 | - | - |
| - | 2470645..2470708 | + | 64 | NuclAT_43 | - | - |
| - | 2470645..2470708 | + | 64 | NuclAT_43 | - | - |
| - | 2470645..2470708 | + | 64 | NuclAT_43 | - | - |
| RG46_RS24980 | 2471023..2471130 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2471183..2471244 | + | 62 | NuclAT_38 | - | - |
| - | 2471183..2471244 | + | 62 | NuclAT_38 | - | - |
| - | 2471183..2471244 | + | 62 | NuclAT_38 | - | - |
| - | 2471183..2471244 | + | 62 | NuclAT_38 | - | - |
| - | 2471183..2471244 | + | 62 | NuclAT_40 | - | - |
| - | 2471183..2471244 | + | 62 | NuclAT_40 | - | - |
| - | 2471183..2471244 | + | 62 | NuclAT_40 | - | - |
| - | 2471183..2471244 | + | 62 | NuclAT_40 | - | - |
| - | 2471183..2471244 | + | 62 | NuclAT_42 | - | - |
| - | 2471183..2471244 | + | 62 | NuclAT_42 | - | - |
| - | 2471183..2471244 | + | 62 | NuclAT_42 | - | - |
| - | 2471183..2471244 | + | 62 | NuclAT_42 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_27 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_27 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_27 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_27 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_29 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_29 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_29 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_29 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_31 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_31 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_31 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_31 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_33 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_33 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_33 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_33 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_35 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_35 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_35 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_35 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_37 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_37 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_37 | - | - |
| - | 2471183..2471245 | + | 63 | NuclAT_37 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_15 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_15 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_15 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_15 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_17 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_17 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_17 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_17 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_19 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_19 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_19 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_19 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_21 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_21 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_21 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_21 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_23 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_23 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_23 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_23 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_25 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_25 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_25 | - | - |
| - | 2471183..2471246 | + | 64 | NuclAT_25 | - | - |
| RG46_RS12735 | 2471559..2471666 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2471714..2471781 | + | 68 | NuclAT_14 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_14 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_14 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_14 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_16 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_16 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_16 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_16 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_18 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_18 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_18 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_18 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_20 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_20 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_20 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_20 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_22 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_22 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_22 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_22 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_24 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_24 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_24 | - | - |
| - | 2471714..2471781 | + | 68 | NuclAT_24 | - | - |
| RG46_RS12740 | 2472071..2473171 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| RG46_RS12745 | 2473441..2473671 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| RG46_RS12750 | 2473829..2474524 | + | 696 | WP_001355927.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| RG46_RS12755 | 2474568..2474921 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T51000 WP_000170954.1 NZ_CP010167:c2470595-2470488 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T51000 NZ_CP010167:c2470595-2470488 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT51000 NZ_CP010167:2470643-2470709 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|