Detailed information of TA system TA050796

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 58792..59046
• Replicon: plasmid B
• Accession: NZ_CP010147
• Organism: Escherichia coli strain D5

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: RG38_RS26380
• Protein ID: WP_001351576.1
• Coordinates: 58792..58998 (-)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	58985..59046 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
RG38_RS26335	54344..54745	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
RG38_RS27720	54678..54935	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
RG38_RS26345	55028..55681	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
RG38_RS26355	56620..57477	-	858	WP_073511591.1	incFII family plasmid replication initiator RepA	-
RG38_RS26360	57470..57952	-	483	WP_001273588.1	hypothetical protein	-
RG38_RS26365	57945..58019	-	75	WP_001442103.1	RepA leader peptide Tap	-
RG38_RS26375	58251..58508	-	258	WP_000083845.1	replication regulatory protein RepA	-
RG38_RS26380	58792..58998	-	207	WP_001351576.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	58985..59046	+	62	NuclAT_1	-	Antitoxin
-	58985..59046	+	62	NuclAT_1	-	Antitoxin
-	58985..59046	+	62	NuclAT_1	-	Antitoxin
-	58985..59046	+	62	NuclAT_1	-	Antitoxin
RG38_RS27875	59302..59376	-	75	Protein_64	endonuclease	-
RG38_RS26390	59622..59834	-	213	WP_001299730.1	ANR family transcriptional regulator	-
RG38_RS26395	59970..60530	-	561	WP_000139315.1	fertility inhibition protein FinO	-
RG38_RS26400	60633..61493	-	861	WP_000704514.1	alpha/beta hydrolase	-
RG38_RS26405	61552..62298	-	747	WP_000205749.1	conjugal transfer pilus acetylase TraX	-
RG38_RS26410	62318..63274	-	957	Protein_69	conjugative transfer relaxase/helicase TraI	-
RG38_RS26415	63326..64030	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	sitABCD	iucA / iucB / iucC / iucD / iutA / iroN / iroE / iroD / iroC / iroB	1..88754	88754
	-	flank	IS/Tn	-	-	53820..54095	275
	-	flank	IS/Tn	-	-	63326..64030	704

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7826.31 Da
• Isoelectric Point: 8.8807

>T50796 WP_001351576.1 NZ_CP010147:c58998-58792 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

>T50796 NZ_CP010147:c58998-58792 [Escherichia coli]
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 62 bp

>AT50796 NZ_CP010147:58985-59046 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin